O60829 PAGE4_HUMAN

Gene name: PAGE4
Protein name: P antigen family member 4

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell death GO:0008219
- cellular protein modification process GO:0006464
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8WWM1 XAGE5 0.67942
2 Q9HC77 CENPJ 0.6531 cell cycle GO:0007049
cell division GO:0051301
cellular component assembly GO:0022607
...
3 Q32P28 P3H1 0.63542 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell population proliferation GO:0008283
...
4 O95125 ZNF202 0.63244 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
5 P62258 YWHAE 0.61534 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
cell cycle GO:0007049
...
6 P06756 ITGAV 0.60984 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biological process involved in symbiotic interaction GO:0044403
...
7 P34932 HSPA4 0.60297 cellular component assembly GO:0022607
membrane organization GO:0061024
protein targeting GO:0006605
...
8 Q92637 FCGR1B 0.6008 immune system process GO:0002376
response to stress GO:0006950
signal transduction GO:0007165
...
9 Q5QJ38 TCHHL1 0.59554
10 P12314 FCGR1A 0.59243 cellular protein modification process GO:0006464
immune system process GO:0002376
membrane organization GO:0061024
...

                                           20                  40                  60                  80                 100
AA:                      MSARVRSRSRGRGDGQEAPDVVAFVAPGESQQEEPPTDNQDIEPGQEREGTPPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDG
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................DDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PQ]:                                         PgesQQeePPtdnQdiePgQ                                                      
RICH_[D]:                                                                             DcqemDlektrsergDgsD                    
RICH_[E]:                                                          EpgqErEgtppiEErkvE                                        
RICH_[K]:                                                                                                 KeKtppnpKhaKtK     
RICH_[Q]:                                              QQeepptdnQdiepgQ                                                      
RICH_[EI]:                                                        IEpgqErEgtppIEE                                            
RICH_[EP]:                               EaPdvvafvaPgEsqqEEPP                                                                
RICH_[EQ]:                                           EsQQEEpptdnQdiEpgQErE                                                   
RICH_[GR]:                    RsRsRGRGdG                                                                                     
RICH_[KP]:                                                                                                  KtPPnPKhaKtKeagdg
RICH_fLPS_[R]:             aRvRsRsRgR                                                                                        
RICH_MOBI_[D]:                                                                        DcqemDlektrsergDgsD                    
RICH_MOBI_[E]:                                                     EpgqErEgtppiEErkvE                                        
RICH_MOBI_[K]:                                                                                            KeKtppnpKhaKtK     
RICH_MOBI_[Q]:                                         QQeepptdnQdiepgQ                                                      
RICH_MOBI_[EI]:                                                   IEpgqErEgtppIEErkvE                                        
RICH_MOBI_[EQ]:                                      EsQQEEpptdnQdiEpgQErE                                                   
RICH_MOBI_[GR]:               RsRsRGRGdG                                                                                     
RICH_fLPS_MOBI_[R]:        aRvRsRsRgR                                                                                        

                                           
AA:                      QP
STMI:                      
DO_DISOPRED3:            DD
DO_IUPRED2A:             DD
DO_SPOTD:                DD
CONSENSUS:               DD
CONSENSUS_MOBI:          DD
RICH_[KP]:               qP