O75896 TUSC2_HUMAN
Gene name: TUSC2
Protein name: Tumor suppressor candidate 2
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- cell cycle GO:0007049
- cell differentiation GO:0030154
- developmental maturation GO:0021700
- immune system process GO:0002376
- response to stress GO:0006950
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9GZN4 | PRSS22 | 0.9088 | |
| 2 | Q93098 | WNT8B | 0.90659 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 3 | Q9UNW9 | NOVA2 | 0.90332 | cellular nitrogen compound metabolic process GO:0034641 homeostatic process GO:0042592 mRNA processing GO:0006397 |
| 4 | Q96FZ5 | CMTM7 | 0.88671 | anatomical structure development GO:0048856 cell differentiation GO:0030154 immune system process GO:0002376 |
| 5 | P0C2W1 | FBXO45 | 0.86189 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 6 | Q76EJ3 | SLC35D2 | 0.85556 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 transport GO:0006810 |
| 7 | Q4G148 | GXYLT1 | 0.85508 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 8 | Q96CN7 | ISOC1 | 0.84946 | |
| 9 | P86791 | CCZ1 | 0.84758 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 10 | P23942 | PRPH2 | 0.843 | anatomical structure development GO:0048856 cell adhesion GO:0007155 nervous system process GO:0050877 |
20 40 60 80 100 AA: MGASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIH STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_IUPRED2A: ........................DDDDDDDD..........................................D....D.................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[AG]: GAsGskArGlwpfAsAAGGGGseAAGAeqA RICH_[A]: ArglwpfAsAAggggseAAgAeqA RICH_[G]: GasGskarGlwpfasaaGGGG RICH_fLPS_[A]: AsAAggggseAAgAeqA RICH_fLPS_[G]: aGGGGseaaG
AA: VDFPVILYEV STMI: DO_DISOPRED3: .......... DO_IUPRED2A: .......... DO_SPOTD: .......... CONSENSUS: .......... CONSENSUS_MOBI: ..........