Q96FZ5 CKLF7_HUMAN
Gene name: CMTM7
Protein name: CKLF-like MARVEL transmembrane domain-containing protein 7
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- immune system process GO:0002376
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9GZN4 | PRSS22 | 0.96239 | |
| 2 | Q93098 | WNT8B | 0.96113 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
| 3 | P23942 | PRPH2 | 0.93346 | anatomical structure development GO:0048856 cell adhesion GO:0007155 nervous system process GO:0050877 |
| 4 | Q9NWW5 | CLN6 | 0.92245 | catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 homeostatic process GO:0042592 ... |
| 5 | P30532 | CHRNA5 | 0.92245 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 6 | O75896 | TUSC2 | 0.88671 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell cycle GO:0007049 ... |
| 7 | Q9NWH2 | TMEM242 | 0.81241 | |
| 8 | Q4G148 | GXYLT1 | 0.81009 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 9 | O95295 | SNAPIN | 0.80245 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
| 10 | Q76EJ3 | SLC35D2 | 0.79569 | biosynthetic process GO:0009058 small molecule metabolic process GO:0044281 transport GO:0006810 |
20 40 60 80 100 AA: MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFY STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........ ............. ... CONSENSUS_MOBI: .......................................... ............. ... RICH_[AG]: AGlvrttcssGsAlGpGAGAAqpsAspleG RICH_[A]: AlgpgAgAAqpsA RICH_[G]: GaGlvrttcssGsalGpGaG
120 140 160 AA: RVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .....................................................................DDDDDD DO_IUPRED2A: ........................................................................... DO_SPOTD: ..................................................................DDDDDDDDD CONSENSUS: ......... ......... .........DDDDDD CONSENSUS_MOBI: ......... ......... ...............