O75934 SPF27_HUMAN
Gene name: BCAS2
Protein name: Pre-mRNA-splicing factor SPF27
List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9P121 | NTM | 0.70711 | |
| 2 | Q9BYG4 | PARD6G | 0.59662 | cell cycle GO:0007049 cell division GO:0051301 cell junction organization GO:0034330 ... |
| 3 | Q8NHU0 | CT45A3 | 0.57134 | cellular nitrogen compound metabolic process GO:0034641 |
| 4 | Q9H9E3 | COG4 | 0.54391 | cellular component assembly GO:0022607 protein transport GO:0015031 protein-containing complex assembly GO:0065003 ... |
| 5 | Q86XR2 | NIBAN3 | 0.49989 | |
| 6 | Q12860 | CNTN1 | 0.48507 | |
| 7 | Q8IWV2 | CNTN4 | 0.46575 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 8 | Q9P232 | CNTN3 | 0.45018 | anatomical structure development GO:0048856 cell adhesion GO:0007155 |
| 9 | P33176 | KIF5B | 0.39642 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 ... |
| 10 | Q9HAA7 | n/a | 0.38279 |
20 40 60 80 100 AA: MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDI STMI: DO_DISOPRED3: DDDDDDDDDD.......................................DDD................................................ DO_IUPRED2A: .............................D.....D...............................................................D DO_SPOTD: DDDDDD.............................................................................................. CONSENSUS: DDDDDD.............................................................................................. CONSENSUS_MOBI: DDDDDDDDDDDD........................................................................................ RICH_MOBI_[GV]: GtGlVaGeVV
120 140 160 180 200 AA: TAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIV STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .........................................................................D.......................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 AA: QLENEIYQIKQQHGEANKENIRQDF STMI: DO_DISOPRED3: ..............DDDDDDDDDDD DO_IUPRED2A: ............DD...DDDDDDDD DO_SPOTD: ............DDDDDDDDDDDDD CONSENSUS: ............DDDDDDDDDDDDD CONSENSUS_MOBI: .........................