Q8NHU0 CT453_HUMAN

Gene name: CT45A3
Protein name: Cancer/testis antigen family 45 member A3

List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5HYN5 CT45A1 0.90928 cellular nitrogen compound metabolic process GO:0034641
2 P0DMV0 CT45A7 0.8587 cellular nitrogen compound metabolic process GO:0034641
3 Q5DJT8 CT45A2 0.73814 cellular nitrogen compound metabolic process GO:0034641
4 O75934 BCAS2 0.57134 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
5 Q96NL3 ZNF599 0.55523
6 Q7Z412 PEX26 0.53324 protein targeting GO:0006605
protein transport GO:0015031
transmembrane transport GO:0055085
...
7 P61587 RND3 0.53294 cell adhesion GO:0007155
cytoskeleton organization GO:0007010
signal transduction GO:0007165
8 A8MPY1 GABRR3 0.52763 cell-cell signaling GO:0007267
nervous system process GO:0050877
signal transduction GO:0007165
...
9 Q9BYG4 PARD6G 0.52595 cell cycle GO:0007049
cell division GO:0051301
cell junction organization GO:0034330
...
10 Q8WV83 SLC35F5 0.52098

                                           20                  40                  60                  80                 100
AA:                      MTDKTEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKEKKLMTGHAIPPSQLDSQIDDFTGFSKDRMMQKPGSNAPVGGNVTS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDD...DD....................DD.DDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDD...DDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ................................................................................DDDDDDDDDDDDDDDDDDDD
RICH_[D]:                                                                                     DsqiDDftgfskD                  
RICH_[K]:                                                      KqgagdsliagsamsKeKK                                           
RICH_[R]:                                 RpRecdspsyqkRqRmallaR                                                              
RICH_[S]:                                                                                                                   S
RICH_[DF]:                                                                                    DsqiDDFtgFskD                  
RICH_[DI]:                                                                              IppsqlDsqIDD                         
RICH_[DM]:                                                                                        DDftgfskDrMM               
RICH_[FM]:                                                                                          FtgFskdrMM               
RICH_MOBI_[GV]:                                                                                                  GsnapVGGnV  

                                          120                 140                 160                 180           
AA:                      SFSGDDLECRETASSPKSQREINADIKRKLVKELRCVGQKYEKIFEMLEGVQGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI
STMI:                                                                                                             
DO_DISOPRED3:            DDDDDDDDDDD..............................................................................
DO_IUPRED2A:             ....DDDDDDDDDDDDDDDDDDDDD................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDD.....................................................................DD
CONSENSUS:               DDDDDDDDDDDDDDDDDD.......................................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDD......................................................................
RICH_[S]:                SfSgddlecretaSSpkS