O95295 SNAPN_HUMAN
Gene name: SNAPIN
Protein name: SNARE-associated protein Snapin
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- catabolic process GO:0009056
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cell-cell signaling GO:0007267
- cytoskeleton-dependent intracellular transport GO:0030705
- developmental maturation GO:0021700
- homeostatic process GO:0042592
- membrane organization GO:0061024
- protein maturation GO:0051604
- protein transport GO:0015031
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y664 | KPTN | 0.99954 | cytoskeleton organization GO:0007010 response to stress GO:0006950 signal transduction GO:0007165 |
| 2 | Q99836 | MYD88 | 0.99954 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
| 3 | Q9NWH2 | TMEM242 | 0.99934 | |
| 4 | O75503 | CLN5 | 0.98916 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
| 5 | Q7Z4R8 | C6orf120 | 0.95995 | cell death GO:0008219 immune system process GO:0002376 transport GO:0006810 ... |
| 6 | Q2TBF2 | WSCD2 | 0.89468 | |
| 7 | Q9C029 | TRIM7 | 0.88129 | cellular protein modification process GO:0006464 |
| 8 | A6NFF2 | NAP1L6P | 0.87427 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
| 9 | Q9GZN4 | PRSS22 | 0.84519 | |
| 10 | Q93098 | WNT8B | 0.82962 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
20 40 60 80 100 AA: MAGAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVHAVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQ STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDD................................................................................ DO_IUPRED2A: ....D...DDDDDD...................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDD................................................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[AG]: AGAGsAAvsGAGtpvAG RICH_[A]: AgAgsAAvsgAgtpvA
120 AA: NAQERLRRLNHSVAKETARRRAMLDSGIYPPGSPGK STMI: DO_DISOPRED3: .....................D.DDDDDDDDDDDDD DO_IUPRED2A: ........DDDDD...D......DDDDDDDDDDDDD DO_SPOTD: ...........DDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...........DDDDDD....DDDDDDDDDDDDDDD CONSENSUS_MOBI: ....................................