Q9NWH2 TM242_HUMAN
Gene name: TMEM242
Protein name: Transmembrane protein 242
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | O95295 | SNAPIN | 0.99934 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 ... |
2 | Q9Y664 | KPTN | 0.99779 | cytoskeleton organization GO:0007010 response to stress GO:0006950 signal transduction GO:0007165 |
3 | Q99836 | MYD88 | 0.99779 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
4 | O75503 | CLN5 | 0.98318 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell differentiation GO:0030154 ... |
5 | Q7Z4R8 | C6orf120 | 0.94916 | cell death GO:0008219 immune system process GO:0002376 transport GO:0006810 ... |
6 | Q2TBF2 | WSCD2 | 0.89502 | |
7 | A6NFF2 | NAP1L6P | 0.8787 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
8 | Q9C029 | TRIM7 | 0.87017 | cellular protein modification process GO:0006464 |
9 | Q9GZN4 | PRSS22 | 0.84532 | |
10 | Q93098 | WNT8B | 0.82959 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell-cell signaling GO:0007267 ... |
20 40 60 80 100 AA: METAGAATGQPASGLEAPGSTNDRLFLVKGGIFLGTVAAAGMLAGFITTLSLAKKKSPEWFNKGSMATAALPESGSSLALRALGWGSLYAWCGVGVISFA STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDD................................................................................ DO_IUPRED2A: DDDD...DDDDDDDD..................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDDDD......... ............................... CONSENSUS_MOBI: ............................. ............................... RICH_[AG]: AGAAtGqpAsGleApG RICH_[A]: AgAAtgqpAsgleA
120 140 AA: VWKALGVHSMNDFRSKMQSIFPTIPKNSESAVEWEETLKSK STMI: MM DO_DISOPRED3: .......................................DD DO_IUPRED2A: ..................................D...... DO_SPOTD: .....................................DDDD CONSENSUS: .....................................DD CONSENSUS_MOBI: .......................................