Q9NWH2 TM242_HUMAN

Gene name: TMEM242
Protein name: Transmembrane protein 242

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O95295 SNAPIN 0.99934 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
catabolic process GO:0009056
...
2 Q9Y664 KPTN 0.99779 cytoskeleton organization GO:0007010
response to stress GO:0006950
signal transduction GO:0007165
3 Q99836 MYD88 0.99779 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
4 O75503 CLN5 0.98318 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
5 Q7Z4R8 C6orf120 0.94916 cell death GO:0008219
immune system process GO:0002376
transport GO:0006810
...
6 Q2TBF2 WSCD2 0.89502
7 A6NFF2 NAP1L6P 0.8787 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
8 Q9C029 TRIM7 0.87017 cellular protein modification process GO:0006464
9 Q9GZN4 PRSS22 0.84532
10 Q93098 WNT8B 0.82959 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell-cell signaling GO:0007267
...

                                           20                  40                  60                  80                 100
AA:                      METAGAATGQPASGLEAPGSTNDRLFLVKGGIFLGTVAAAGMLAGFITTLSLAKKKSPEWFNKGSMATAALPESGSSLALRALGWGSLYAWCGVGVISFA
STMI:                                                 MMMMMMMMMMMMMMMMMMMMM                               MMMMMMMMMMMMMMMMMMM
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDD................................................................................
DO_IUPRED2A:             DDDD...DDDDDDDD.....................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDD..............................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDD.........                     ...............................                   
CONSENSUS_MOBI:          .............................                     ...............................                   
RICH_[AG]:                  AGAAtGqpAsGleApG                                                                                 
RICH_[A]:                   AgAAtgqpAsgleA                                                                                   

                                          120                 140                   
AA:                      VWKALGVHSMNDFRSKMQSIFPTIPKNSESAVEWEETLKSK
STMI:                    MM                                       
DO_DISOPRED3:            .......................................DD
DO_IUPRED2A:             ..................................D......
DO_SPOTD:                .....................................DDDD
CONSENSUS:                 .....................................DD
CONSENSUS_MOBI:            .......................................