O95445 APOM_HUMAN
Gene name: APOM
Protein name: Apolipoprotein M
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- homeostatic process GO:0042592
- protein-containing complex assembly GO:0065003
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6ZN28 | MACC1 | 0.58198 | biosynthetic process GO:0009058 cell division GO:0051301 cellular nitrogen compound metabolic process GO:0034641 |
| 2 | Q8NEP9 | ZNF555 | 0.52981 | |
| 3 | Q9H2U9 | ADAM7 | 0.52981 | |
| 4 | Q6UQ28 | PLET1 | 0.52493 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 5 | Q68DY9 | ZNF772 | 0.49849 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | Q8NGC7 | OR11H6 | 0.46829 | |
| 7 | P29033 | GJB2 | 0.44013 | anatomical structure development GO:0048856 cell junction organization GO:0034330 cell-cell signaling GO:0007267 ... |
| 8 | Q9Y6R6 | ZNF780B | 0.42385 | |
| 9 | Q13557 | CAMK2D | 0.4166 | biosynthetic process GO:0009058 cell death GO:0008219 cellular nitrogen compound metabolic process GO:0034641 ... |
| 10 | A6NHS7 | MANSC4 | 0.40022 |
20 40 60 80 100 AA: MFHQIWAALLYFYGIILNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIVFNMAAGSAPMQLHLRATIRMKDGLCVPRKW STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDD................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: .DDDDDDDDDDDD.DD.................................................................................... CONSENSUS: .DDDDDDDDDDDDDDD.................................................................................... CONSENSUS_MOBI: .................................................................................................... RICH_[I]: IwaallyfygII RICH_[FI]: FhqIwaallyFygII RICH_[IY]: IwaallYfYgII
120 140 160 180 AA: IYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQGYQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN STMI: DO_DISOPRED3: ......................................................................................DD DO_IUPRED2A: ...........DDDDDD.D.........................D........................................DD. DO_SPOTD: ...................................................................................DDDDD CONSENSUS: .....................................................................................DDD CONSENSUS_MOBI: ........................................................................................