P29033 CXB2_HUMAN

Gene name: GJB2
Protein name: Gap junction beta-2 protein

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell junction organization GO:0034330
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- nervous system process GO:0050877
- reproduction GO:0000003
- response to stress GO:0006950
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6UXG2 ELAPOR1 0.58222 catabolic process GO:0009056
cellular component assembly GO:0022607
response to stress GO:0006950
2 Q9NRW1 RAB6B 0.57733 protein transport GO:0015031
signal transduction GO:0007165
transport GO:0006810
...
3 Q8TCF1 ZFAND1 0.56359 protein transport GO:0015031
transport GO:0006810
4 Q8IY21 DDX60 0.53854 immune system process GO:0002376
response to stress GO:0006950
signal transduction GO:0007165
5 Q13557 CAMK2D 0.53183 biosynthetic process GO:0009058
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
6 Q6DHV5 CC2D2B 0.52432
7 Q86V20 SHLD2 0.50127 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...
8 Q86TA1 MOB3B 0.49642 signal transduction GO:0007165
9 Q9NWL6 ASNSD1 0.48833 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
10 Q8N3J2 METTL4 0.48233 cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
DNA metabolic process GO:0006259

                                           20                  40                  60                  80                 100
AA:                      MDWGTLQTILGGVNKHSTSIGKIWLTVLFIFRIMILVVAAKEVWGDEQADFVCNTLQPGCKNVCYDHYFPISHIRLWALQLIFVSTPALLVAMHVAYRRH
STMI:                                        MMMMMMMMMMMMMMMMMMMM                                   MMMMMMMMMMMMMMMMMMMMMMM  
DO_DISOPRED3:            ..............D.D............................DDDDDDDDDDDDDDDDDDDDDD.................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................                    ...................................                       ..
CONSENSUS_MOBI:          ....................                    ...................................                       ..

                                          120                 140                 160                 180                 200
AA:                      EKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWWTYTSSIFFRVIFEAAFMYVFYVMYDGFSMQRLVKCNAWPCPNTVDCFVSRPTEKTVFTVFMIAVSG
STMI:                                                   MMMMMMMMMMMMMMMMMMMMMMM                                      MMMMMMMM
DO_DISOPRED3:            ..DDDDDDDDDDDDDDDDD..........................................................DDDDDDDDDDDDDD.........
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                .DDDDDDDDDDDDDDDDDDD.D..............................................................................
CONSENSUS:               ..DDDDDDDDDDDDDDDDD............                       ......................................        
CONSENSUS_MOBI:          .........DDDDDDDDDDDDDDD.......                       ......................................        
RICH_[I]:                      IkgeIksefkdI                                                                                  
RICH_[K]:                  KrKfiKgeiKsefK                                                                                    
RICH_[EI]:                        EIksEfkdIE                                                                                 
RICH_[FI]:                    FIkgeIkseFkdI                                                                                  
RICH_[FK]:                 KrKFiKgeiKseFK                                                                                    
RICH_[IK]:                 KrKfIKgeIKsefK                                                                                    
RICH_MOBI_[I]:                     IksefkdIeeI                                                                               

                                          220              
AA:                      ICILLNVTELCYLLIRYCSGKSKKPV
STMI:                    MMMMMMMMMMMMMMM           
DO_DISOPRED3:            .......................DDD
DO_IUPRED2A:             ..........................
DO_SPOTD:                ....................DDDDDD
CONSENSUS:                              ........DDD
CONSENSUS_MOBI:                         ..DDDDDDDDD