O95721 SNP29_HUMAN

Gene name: SNAP29
Protein name: Synaptosomal-associated protein 29

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- immune system process GO:0002376
- membrane organization GO:0061024
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8TE02 ELP5 0.76995 cellular nitrogen compound metabolic process GO:0034641
2 Q9BXN1 ASPN 0.7641 anatomical structure development GO:0048856
signal transduction GO:0007165
3 Q0VG06 FAAP100 0.74966 cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
response to stress GO:0006950
4 Q86VP6 CAND1 0.74436 biosynthetic process GO:0009058
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
5 O43829 ZBTB14 0.73971 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
6 P60484 PTEN 0.72203 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
7 P01275 GCG 0.72056 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cell death GO:0008219
...
8 Q6PGQ1 DRICH1 0.72041
9 E9PB15 PTGES3L 0.71563 cellular component assembly GO:0022607
protein folding GO:0006457
protein-containing complex assembly GO:0065003
10 Q15139 PRKD1 0.71551 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQ
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................................
DO_IUPRED2A:             .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDD...DDDD....DD....DDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DD....DDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................................................
RICH_[AD]:                                  ArpApwrDArDlpDgpDApAD                                                            
RICH_[AP]:                                  ArPAPwrdArdlPdgPdAPA                                                             
RICH_[AR]:                                  ARpApwRdAR       ApAdRqqylRqevlRRAeAtAA                                          
RICH_[D]:                           DDDgeDegarpapwrDarDlpDgpDapaD                                                            
RICH_[R]:                                                        RqqylRqevlRR                                                
RICH_[DP]:                   PksynPfDDDgeDegarPaP                                                                            
RICH_[DQ]:                                               DgpDapaDrQQylrQ                                                     
RICH_[DY]:                  YpksYnpfDDDgeD                                                                                   
RICH_fLPS_[D]:                  ynpfDDDgeDegarpapwrDarDlpDgpDapaD                                                            
RICH_MOBI_[AD]:                             ArpApwrDArDlpDgpDA                                                               
RICH_MOBI_[AR]:                             ARpApwRdAR                                                                       
RICH_MOBI_[D]:                      DDDgeDegarpapwrDarDlpDgpD                                                                
RICH_MOBI_[DY]:             YpksYnpfDDDgeD                                                                                   
RICH_fLPS_MOBI_[D]:                 DDDgeDegarpapwrDarDlpD                                                                   

                                          120                 140                 160                 180                 200
AA:                      DLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQ
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........
DO_IUPRED2A:             DDDDD.................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDD.................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........
RICH_[AY]:                                                                                              AgsAmstdAYpknphlrAY  
RICH_[D]:                                                                                      DDtDpvprgagsamstD             
RICH_[N]:                                                  NgtltsqpNN                                                        
RICH_[Y]:                                                                                                        YpknphlraY  
RICH_MOBI_[D]:                                                                                 DDtDpvprgagsamstD             

                                          220                 240  
AA:                      KIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL
STMI:                                                                              
DO_DISOPRED3:            .............................................DDD........DD
DO_IUPRED2A:             DD.................DDD..DDDDDDDDDDD...........D.......D.D.
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DD.................DDDDDDDDDDDDDDDD..........DDD......DDDD
CONSENSUS_MOBI:          ..........................................................
RICH_[DE]:                                        EiEEqDDilD