P01275 GLUC_HUMAN

Gene name: GCG
Protein name: Pro-glucagon [Cleaved into: Glicentin; Glicentin-related polypeptide

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- carbohydrate metabolic process GO:0005975
- cell death GO:0008219
- cell-cell signaling GO:0007267
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- homeostatic process GO:0042592
- protein transport GO:0015031
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9Y5F3 PCDHB1 0.99422 cell adhesion GO:0007155
2 Q7Z7H8 MRPL10 0.98 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
...
3 Q00LT1 PRCD 0.97486 nervous system process GO:0050877
4 P48723 HSPA13 0.97486 protein folding GO:0006457
response to stress GO:0006950
transport GO:0006810
...
5 Q14953 KIR2DS5 0.9564 immune system process GO:0002376
response to stress GO:0006950
6 Q96MP8 KCTD7 0.91558 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
homeostatic process GO:0042592
...
7 A3KMH1 VWA8 0.90676
8 Q6PGQ1 DRICH1 0.89944
9 Q14952 KIR2DS3 0.89161 response to stress GO:0006950
10 Q9BXS9 SLC26A6 0.86621 anatomical structure development GO:0048856
cell differentiation GO:0030154
developmental maturation GO:0021700
...

                                           20                  40                  60                  80                 100
AA:                      MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAE
STMI:                    SSSSSSSSSSSSSSSSSSSS                                                                                
DO_DISOPRED3:            DDDDDDDDDDD..............D.DDDDDDDDDDD................................................DDDDDDDDDD....
DO_IUPRED2A:             .........................DD..DDDDDDDDDDDDDDDDDDDDDDDDDD................................DDDDDDDDD..D.
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................DDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                   .....DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................DDDDDDDDDDDDD.
CONSENSUS_MOBI:                              .....DDDDDDDDDDDDDDDDDDDDDDDDDDD................................................
RICH_[D]:                                                      DplsDpDqmneD                                                  
RICH_MOBI_[D]:                                                 DplsDpDqmneD                                                  

                                          120                 140                 160
AA:                      GTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
STMI:                                                                                                    
DO_DISOPRED3:            ............................DDDDDDDDDDDDDDDDDDDD.............................DDD
DO_IUPRED2A:             ................................................................................
DO_SPOTD:                DDDDDDDDDD.................................................................DDDDD
CONSENSUS:               .............................................................................DDD
CONSENSUS_MOBI:          ................................................................................