O95750 FGF19_HUMAN
Gene name: FGF19
Protein name: Fibroblast growth factor 19
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell population proliferation GO:0008283
- cellular protein modification process GO:0006464
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y394 | DHRS7 | 0.75569 | |
| 2 | Q16576 | RBBP7 | 0.75569 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular component assembly GO:0022607 ... |
| 3 | O75478 | TADA2A | 0.75569 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 4 | Q9BYT1 | SLC17A9 | 0.65493 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 5 | Q9H0N0 | RAB6C | 0.65493 | cell cycle GO:0007049 cytoskeleton organization GO:0007010 mitotic cell cycle GO:0000278 ... |
| 6 | O75311 | GLRA3 | 0.61493 | cell-cell signaling GO:0007267 cellular component assembly GO:0022607 nervous system process GO:0050877 ... |
| 7 | Q9UDY4 | DNAJB4 | 0.58217 | protein folding GO:0006457 response to stress GO:0006950 |
| 8 | Q14558 | PRPSAP1 | 0.58111 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 9 | Q13349 | ITGAD | 0.55376 | cell adhesion GO:0007155 extracellular matrix organization GO:0030198 immune system process GO:0002376 ... |
| 10 | O95801 | TTC4 | 0.54494 | immune system process GO:0002376 response to stress GO:0006950 |
20 40 60 80 100 AA: MRSGCVVVHVWILAGLWLAVAGRPLAFSDAGPHVHYGWGDPIRLRHLYTSGPHGLSSCFLRIRADGVVDCARGQSAHSLLEIKAVALRTVAIKGVHSVRY STMI: SSSSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDD............................................................................... CONSENSUS: ............................................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDD.............................................................
120 140 160 180 200 AA: LCMGADGKMQGLLQYSEEDCAFEEEIRPDGYNVYRSEKHRLPVSLSSAKQRQLYKNRGFLPLSHFLPMLPMVPEEPEDLRGHLESDMFSSPLETDSMDPF STMI: DO_DISOPRED3: .............................................................................DDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ...........................................................................DD.DDDDDDDDDDD.D......... DO_SPOTD: ..................................................DDD..DDDD..............DDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ...........................................................................DDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ............................................................................DDDDDDDDDDDDDD.......... RICH_[DF]: DmFsspletDsmDpF RICH_[DM]: DMfsspletDsMD
AA: GLVTGLEAVRSPSFEK STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDD DO_IUPRED2A: ..D............. DO_SPOTD: DDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDD CONSENSUS_MOBI: ....DDDD.....DDD