Q9H0N0 RAB6C_HUMAN
Gene name: RAB6C
Protein name: Ras-related protein Rab-6C
List of terms from Generic GO subset, which this protein is a part of:
- cell cycle GO:0007049
- cytoskeleton organization GO:0007010
- mitotic cell cycle GO:0000278
- protein transport GO:0015031
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q14558 | PRPSAP1 | 0.88729 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 2 | O95801 | TTC4 | 0.83205 | immune system process GO:0002376 response to stress GO:0006950 |
| 3 | O95750 | FGF19 | 0.65493 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 4 | Q9UIL1 | SCOC | 0.57735 | catabolic process GO:0009056 |
| 5 | P30876 | POLR2B | 0.49588 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | P20340 | RAB6A | 0.49561 | biological process involved in symbiotic interaction GO:0044403 cellular protein modification process GO:0006464 cytoskeleton-dependent intracellular transport GO:0030705 ... |
| 7 | P12814 | ACTN1 | 0.46667 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 8 | Q9UHA3 | RSL24D1 | 0.4537 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | Q9UNH7 | SNX6 | 0.44721 | biosynthetic process GO:0009058 catabolic process GO:0009056 cell death GO:0008219 ... |
| 10 | Q96ME1 | FBXL18 | 0.41443 | catabolic process GO:0009056 cell cycle GO:0007049 cellular protein modification process GO:0006464 ... |
20 40 60 80 100 AA: MSAGGDFGNPLRKFKLVFLGEQSVAKTSLITRFRYDSFDNTYQAIIGIDFLSKTMYLEDGTIGLRLWDTAGQERLRSLIPRYIRDSAAAVVVYDITNVNS STMI: DO_DISOPRED3: DDDDDDDDD........................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDD........................................................................................... CONSENSUS: DDDDDDDDD........................................................................................... CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: FQQTTKWIDDVRTERGSDVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLFRRVAAALPGMESTQDGSREDMSDIKLEKPQEQT STMI: DO_DISOPRED3: .....................................D.D......................................DDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: .................................DDDD.......................................DDDDDDDDDDDDDDDDDDDDD... DO_SPOTD: ............................................................................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ............................................................................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................................................................................... RICH_[DM]: MestqDgsreDMsD
220 240 AA: VSEGGCSCYSPMSSSTLPQKPPYSFIDCSVNIGLNLFPSLITFCNSSLLPVSWR STMI: DO_DISOPRED3: DDDDDDD.DDD..........................................D DO_IUPRED2A: ...DDD.....D.......................................... DO_SPOTD: DDDDD.D.DDDDDDDD.D................................DDDD CONSENSUS: DDDDDDD.DDDD.........................................D CONSENSUS_MOBI: ......................................................