P01160 ANF_HUMAN

Gene name: NPPA
Protein name: Natriuretic peptides A

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- circulatory system process GO:0003013
- growth GO:0040007
- immune system process GO:0002376
- protein folding GO:0006457
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q5T653 MRPL2 0.5552 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
2 Q9UPQ9 TNRC6B 0.54911 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
3 Q6ZSA8 n/a 0.53229
4 Q9Y5R4 HEMK1 0.52284 cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
5 P0C853 BAALC-AS2 0.5117
6 Q9UJA3 MCM8 0.50347 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
7 Q9Y4M8 LINC00588 0.49637
8 Q3KP66 INAVA 0.48556 biosynthetic process GO:0009058
cell junction organization GO:0034330
cellular protein modification process GO:0006464
...
9 P16066 NPR1 0.48414 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
10 O95900 TRUB2 0.45707 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
...

                                           20                  40                  60                  80                 100
AA:                      MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRG
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSS                                                                           
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..................................................DD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                        DDDDDDDD.................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                                   ....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[W]:                                                                                                  Wtgevspaqrdggalgrg
RICH_[EP]:                                                                  PlEdEvvPPqvlsEPnEE                               
RICH_[GW]:                                                                                                 WtGevspaqrdGGalGrG
RICH_MOBI_[W]:                                                                                             Wtgevspaqrdggalgrg
RICH_MOBI_[GW]:                                                                                            WtGevspaqrdGGalGrG

                                          120                 140       
AA:                      PWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRYRR
STMI:                                                                         
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .....................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDD................................................
RICH_[G]:                                               GGrmdriGaqsGlG        
RICH_[L]:                         LLkskLraLLtaprsL                            
RICH_[R]:                      RsallksklRalltapRslRRsscfggRmdR                
RICH_[W]:                pW                                                   
RICH_[CG]:                                            CfGGrmdriGaqsGlGC       
RICH_[GR]:                                        RRsscfGGRmdRiGaqsGlG        
RICH_[GW]:               pW                                                   
RICH_[LR]:                     RsaLLkskLRaLLtapRsLRRsscfggR                   
RICH_MOBI_[W]:           pW                                                   
RICH_MOBI_[GW]:          pW