P0C853 BAAS2_HUMAN

Gene name: BAALC-AS2
Protein name: Putative uncharacterized protein BAALC-AS2

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q7Z6I5 SPATA12 0.72032
2 Q8N7M0 TCTEX1D1 0.61083
3 Q9UPQ9 TNRC6B 0.60363 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
4 Q13492 PICALM 0.60131 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
5 O00522 KRIT1 0.58821
6 A6NJI9 LRRC72 0.57094
7 Q9UGK8 SERGEF 0.53835
8 P47900 P2RY1 0.51536 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
9 P01160 NPPA 0.5117 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
10 Q9UHQ4 BCAP29 0.50934 cell death GO:0008219
cell differentiation GO:0030154
protein transport GO:0015031
...

                                           20                  40                  60                  80                 100
AA:                      MSLKSWHPQSKTKRVGASEGNPQWGSGSMEAPLLSSFLPPLASEAELTGNTWFLHRCSCILNLEESMDSDWGAWWGVSLPRRAPFLIYGSDGPWCTQAGF
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDD...............................................................................
DO_IUPRED2A:             ...........DDDDDDDDDDDD..D..........................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDD..........................................................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................................................
RICH_[W]:                     WhpqsktkrvgasegnpqW                                                                            
RICH_MOBI_[W]:                WhpqsktkrvgasegnpqW                                                                            

                                        
AA:                      PGWGH
STMI:                         
DO_DISOPRED3:            .....
DO_IUPRED2A:             .....
DO_SPOTD:                ...DD
CONSENSUS:               .....
CONSENSUS_MOBI:          .....