P01732 CD8A_HUMAN
Gene name: CD8A
Protein name: T-cell surface glycoprotein CD8 alpha chain
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell differentiation GO:0030154
- immune system process GO:0002376
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y2A9 | B3GNT3 | 0.90969 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular protein modification process GO:0006464 ... |
| 2 | P24043 | LAMA2 | 0.74764 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 3 | Q14164 | IKBKE | 0.73608 | biological process involved in symbiotic interaction GO:0044403 cell death GO:0008219 cellular protein modification process GO:0006464 ... |
| 4 | Q9H4A9 | DPEP2 | 0.70476 | small molecule metabolic process GO:0044281 |
| 5 | Q5JST6 | EFHC2 | 0.70473 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 6 | Q96HD1 | CRELD1 | 0.70467 | anatomical structure development GO:0048856 |
| 7 | Q9NYA1 | SPHK1 | 0.70467 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 8 | O14543 | SOCS3 | 0.70219 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 9 | P17405 | SMPD1 | 0.70109 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 10 | P27986 | PIK3R1 | 0.69697 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
20 40 60 80 100 AA: MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVL STMI: SSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDD.DDD.DD............................................................................ DO_IUPRED2A: ..................................................................................DDDDD............. DO_SPOTD: DDDDDDDDDDDDDDD..................................................................................... CONSENSUS: ............................................................................... CONSENSUS_MOBI: ...............................................................................
120 140 160 180 200 AA: TLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSL STMI: MMMMMMMMMMMMMMMMMM DO_DISOPRED3: ..................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................... DO_IUPRED2A: ......................................DDDDDDDDDDDDDDD............................................... DO_SPOTD: .................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................. CONSENSUS: ..................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........... CONSENSUS_MOBI: ...................................DDDDDD......................................... RICH_[PT]: PTTTPaPrPPTPaPTiasqP RICH_[AP]: AkPtttPAPrPPtPAPtiA RICH_[AT]: AkpTTTpAprppTpApTiA RICH_[P]: PtttPaPrPPtPaPtiasqPlslrP RICH_[T]: TTTpaprppTpapT RICH_fLPS_[P]: kPtttPaPrPPtPaPtiasqPlslrP
220 AA: VITLYCNHRNRRRVCKCPRPVVKSGDKPSLSARYV STMI: MMM DO_DISOPRED3: .......................DDDDDDDDDDDD DO_IUPRED2A: ................................... DO_SPOTD: .................DDDDDDDDDDDDDDDDDD CONSENSUS: ....................DDDDDDDDDDDD CONSENSUS_MOBI: ................................