O14543 SOCS3_HUMAN
Gene name: SOCS3
Protein name: Suppressor of cytokine signaling 3
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- cell differentiation GO:0030154
- cellular protein modification process GO:0006464
- embryo development GO:0009790
- growth GO:0040007
- immune system process GO:0002376
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P17405 | SMPD1 | 0.99986 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 2 | P27986 | PIK3R1 | 0.99801 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 3 | Q96HD1 | CRELD1 | 0.99779 | anatomical structure development GO:0048856 |
| 4 | Q9NYA1 | SPHK1 | 0.99779 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 5 | Q5JST6 | EFHC2 | 0.9949 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 6 | Q969L2 | MAL2 | 0.96226 | anatomical structure development GO:0048856 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 7 | Q0P6H9 | TMEM62 | 0.90075 | |
| 8 | Q9NVV9 | THAP1 | 0.87035 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell population proliferation GO:0008283 ... |
| 9 | P04180 | LCAT | 0.83689 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 homeostatic process GO:0042592 ... |
| 10 | O14931 | NCR3 | 0.83607 | immune system process GO:0002376 response to stress GO:0006950 signal transduction GO:0007165 |
20 40 60 80 100 AA: MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGG STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDD................................................................................. DO_IUPRED2A: ................................................................................DD........D......... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDD............................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDD................................................................................. CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200 AA: SFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGH STMI: DO_DISOPRED3: .........................................DDDDDDDDDDDDDDDDDD......................................... DO_IUPRED2A: .DDDDDDDD.....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................... DO_SPOTD: .................................DDDDDDDDDDDDDDDDDDDDDDDDDD......................................... CONSENSUS: .................................DDDDDDDDDDDDDDDDDDDDDDDDDD......................................... CONSENSUS_MOBI: .................................................................................................... RICH_[P]: PsfPsPPtePssevPeqPsaqPlP RICH_fLPS_[P]: PsPPtePssevPeqPsaqPlP
220 AA: LDSYEKVTQLPGPIREFLDQYDAPL STMI: DO_DISOPRED3: ......................... DO_IUPRED2A: ..DDDD................... DO_SPOTD: ......................... CONSENSUS: ......................... CONSENSUS_MOBI: .........................