P02649 APOE_HUMAN
Gene name: APOE
Protein name: Apolipoprotein E
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell death GO:0008219
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- circulatory system process GO:0003013
- cytoskeleton organization GO:0007010
- growth GO:0040007
- homeostatic process GO:0042592
- immune system process GO:0002376
- membrane organization GO:0061024
- nervous system process GO:0050877
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O96024 | B3GALT4 | 0.9604 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 |
| 2 | Q96I23 | PYURF | 0.8064 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 3 | Q53RY4 | KRTCAP3 | 0.79931 | |
| 4 | Q8WW22 | DNAJA4 | 0.74531 | cellular component assembly GO:0022607 protein folding GO:0006457 response to stress GO:0006950 |
| 5 | Q9NR28 | DIABLO | 0.73263 | cell death GO:0008219 response to stress GO:0006950 signal transduction GO:0007165 |
| 6 | Q9BRJ2 | MRPL45 | 0.70997 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 7 | Q07021 | C1QBP | 0.67715 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 8 | Q86W25 | NLRP13 | 0.67054 | |
| 9 | P12271 | RLBP1 | 0.64898 | nervous system process GO:0050877 small molecule metabolic process GO:0044281 |
| 10 | P06756 | ITGAV | 0.63575 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biological process involved in symbiotic interaction GO:0044403 ... |
20 40 60 80 100 AA: MKVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQL STMI: SSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDD................................................................... DO_IUPRED2A: .......................DDDDDDDDDDDDDD............................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDD............................................................... CONSENSUS_MOBI: .................................................................................. RICH_[E]: EqavEtEpEpE RICH_[EQ]: EQavEtEpEpElrQQ
120 140 160 180 200 AA: TPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLG STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ..DD......D...............................................................................D......... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 260 280 300 AA: PLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEK STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .............D.............D...DDDDD..DDDDDDDDDDDD.................................................. DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: VQAAVGTSAAPVPSDNH STMI: DO_DISOPRED3: .....DDDDDDDDDDDD DO_IUPRED2A: ....DDDDDDDDDDDDD DO_SPOTD: .....DDDDDDDDDDDD CONSENSUS: .....DDDDDDDDDDDD CONSENSUS_MOBI: .................