Q96I23 PREY_HUMAN

Gene name: PYURF
Protein name: Protein preY, mitochondrial

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular protein modification process GO:0006464

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q86W25 NLRP13 0.83152
2 P02649 APOE 0.8064 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
3 Q8N7A1 KLHDC1 0.8064
4 Q8N8N0 RNF152 0.70711 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
...
5 Q96FW1 OTUB1 0.70711 cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
6 P32455 GBP1 0.66227 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
7 Q53RY4 KRTCAP3 0.62197
8 O60518 RANBP6 0.61199 nucleocytoplasmic transport GO:0006913
protein transport GO:0015031
transport GO:0006810
9 Q96PP8 GBP5 0.60971 cellular component assembly GO:0022607
immune system process GO:0002376
protein-containing complex assembly GO:0065003
...
10 Q8WW22 DNAJA4 0.59628 cellular component assembly GO:0022607
protein folding GO:0006457
response to stress GO:0006950

                                           20                  40                  60                  80                 100
AA:                      MLSGARCRLASALRGTRAPPSAVARRCLHASGSRPLADRGKKTEEPPRDFDPALLEFLVCPLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAAR
STMI:                    TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTT                                                                 
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDD..D.DDDDDDDDDDDDDDDDDD......................................................
DO_IUPRED2A:             ......................DDDD.DDD..DDDDDDDDDDDDDDDD...............................................DDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................................................D
CONSENSUS:                                                  DDDDDDDDDDD.....................................................D
CONSENSUS_MOBI:                                             DDDDDDDDDDDDDD...................................................

                               
AA:                      MTRQSKKQEEVEQR
STMI:                                  
DO_DISOPRED3:            .......DDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..............
RICH_[EQ]:                  QskkQEEvEQ