P04921 GLPC_HUMAN

Gene name: GYPC
Protein name: Glycophorin-C

List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BQC3 DPH2 0.47457 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
2 P15621 ZNF44 0.43827 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 Q9Y5Z4 HEBP2 0.42505 cell death GO:0008219
immune system process GO:0002376
membrane organization GO:0061024
...
4 Q9Y233 PDE10A 0.42505 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
5 B1ANY3 FAM220BP 0.4171 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
6 Q8N131 TMEM123 0.40299 cell death GO:0008219
7 Q8WTV0 SCARB1 0.39293 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
8 P0C853 BAALC-AS2 0.37234
9 Q7Z4R8 C6orf120 0.36637 cell death GO:0008219
immune system process GO:0002376
transport GO:0006810
...
10 Q8N653 LZTR1 0.36045 anatomical structure development GO:0048856
cellular protein modification process GO:0006464
signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTE
STMI:                                                                             MMMMMMMMMMMMMMMMMMMMMMMM                   
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................DD
DO_IUPRED2A:             D........DDDDDDDDD...DDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................................DDD..
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......                        ..............DDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........                        ...................
RICH_[PW]:                WstrsPnstaWPlslePdP                                                                                
RICH_[A]:                                                                                                               Akgte
RICH_[W]:                 WstrspnstaW                                                                                        
RICH_[GM]:                                                      GMsGwpdGrM                                                   
RICH_[MT]:                                    MasasTTMhTTT                                                                   
RICH_fLPS_[T]:                                  sasTTmhTTT                                                                   
RICH_MOBI_[W]:            WstrspnstaW                                                                                        
RICH_MOBI_[MT]:                               MasasTTMhTTTiaepdpgM                                                           
RICH_fLPS_MOBI_[T]:                             sasTTmhTTT                                                                   

                                          120            
AA:                      FAESADAALQGDPALQDAGDSSRKEYFI
STMI:                                                
DO_DISOPRED3:            DD.DDDDDD..DD...............
DO_IUPRED2A:             .DDDD.DDDD.DDDDD............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDD............
CONSENSUS_MOBI:          .......DDDDDDDDDDDDDDD......
RICH_[A]:                fAesAdAAlqgdpA