P05230 FGF1_HUMAN
Gene name: FGF1
Protein name: Fibroblast growth factor 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cell division GO:0051301
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- growth GO:0040007
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8NCL8 | TMEM116 | 0.70711 | |
| 2 | Q86XQ3 | CATSPER3 | 0.43811 | anatomical structure development GO:0048856 cell differentiation GO:0030154 developmental maturation GO:0021700 ... |
| 3 | Q8IZV2 | CMTM8 | 0.40175 | anatomical structure development GO:0048856 |
| 4 | P47898 | HTR5A | 0.37242 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 signal transduction GO:0007165 |
| 5 | Q9BSR8 | YIPF4 | 0.36662 | biological process involved in symbiotic interaction GO:0044403 |
| 6 | Q9H8K7 | PAAT | 0.30585 | |
| 7 | P28566 | HTR1E | 0.28878 | cell-cell signaling GO:0007267 signal transduction GO:0007165 |
| 8 | Q9H1M0 | NUP62CL | 0.2464 | protein transport GO:0015031 transport GO:0006810 |
| 9 | P17035 | ZNF28 | 0.24325 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 10 | Q9NZI5 | GRHL1 | 0.22704 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLF STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDD.................................................................................. DO_IUPRED2A: ...............................................DDDDDDDD.DD.......................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDD.............................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDD.................................................................................. CONSENSUS_MOBI: DDDD................................................................................................ RICH_[FT]: TTFTalTekF
120 140 AA: LERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD STMI: DO_DISOPRED3: ......................................................D DO_IUPRED2A: ....................................................... DO_SPOTD: ......................................................D CONSENSUS: ......................................................D CONSENSUS_MOBI: .......................................................