Q9BSR8 YIPF4_HUMAN

Gene name: YIPF4
Protein name: Protein YIPF4

List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q69YG0 TMEM42 0.80159
2 P48145 NPBWR1 0.73324 cell-cell signaling GO:0007267
signal transduction GO:0007165
3 Q9Y6K5 OAS3 0.73324 biological process involved in symbiotic interaction GO:0044403
cellular nitrogen compound metabolic process GO:0034641
immune system process GO:0002376
...
4 P52943 CRIP2 0.73324 anatomical structure development GO:0048856
cell population proliferation GO:0008283
immune system process GO:0002376
5 Q14164 IKBKE 0.72948 biological process involved in symbiotic interaction GO:0044403
cell death GO:0008219
cellular protein modification process GO:0006464
...
6 P41273 TNFSF9 0.69842 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell death GO:0008219
...
7 P15941 MUC1 0.69285 biosynthetic process GO:0009058
cell adhesion GO:0007155
cell cycle GO:0007049
...
8 Q8N1D0 SLC22A18AS 0.68522
9 O75147 OBSL1 0.6746 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell cycle GO:0007049
...
10 P0C864 DANCR 0.65657

                                           20                  40                  60                  80                 100
AA:                      MQPPGPPPAYAPTNGDFTFVSSADAEDLSGSIASPDVKLNLGGDFIKESTATTFLRQRGYGWLLEVEDDDPEDNKPLLEELDIDLKDIYYKIRCVLMPMP
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDD...................................................................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AP]:                    PPPAyAPtngdftfvssAdA                                                                           
RICH_[P]:                  PPgPPPayaP                                                                                        
RICH_[DF]:                              DFtFvssaDaeD                                                                         
RICH_[FT]:                                                           FikesTaTTF                                              

                                          120                 140                 160                 180                 200
AA:                      SLGFNRQVVRDNPDFWGPLAVVLFFSMISLYGQFRVVSWIITIWIFGSLTIFLLARVLGGEVAYGQVLGVIGYSLLPLIVIAPVLLVVGSFEVVSTLIKL
STMI:                                 MMMMMMMMMMMMMMMMMMMMM    MMMMMMMMMMMMMMMMMMMMM       MMMMMMMMMMMMMMMMMMMMM        MMMMM
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               .............                     ....                     .......                     ........     
CONSENSUS_MOBI:          .............                     ....                     .......                     ........     

                                          220                 240                
AA:                      FGVFWAAYSAASLLVGEEFKTKKPLLIYPIFLLYIYFLSLYTGV
STMI:                    MMMMMMMMMMMMMMMM       MMMMMMMMMMMMMMMMMMMMM
DO_DISOPRED3:            ............................................
DO_IUPRED2A:             ............................................
DO_SPOTD:                ............................................
CONSENSUS:                               .......                     
CONSENSUS_MOBI:                          .......