P05813 CRBA1_HUMAN
Gene name: CRYBA1
Protein name: Beta-crystallin A3 [Cleaved into: Beta-crystallin A3, isoform A1, Delta4 form; Beta-crystallin A3, isoform A1, Delta7 form; Beta-crystallin A3, isoform A1, Delta8 form]
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- cellular protein modification process GO:0006464
- nervous system process GO:0050877
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P01589 | IL2RA | 0.75452 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell death GO:0008219 ... |
| 2 | Q7Z3U7 | MON2 | 0.64049 | protein transport GO:0015031 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 3 | Q9HCJ1 | ANKH | 0.63947 | anatomical structure development GO:0048856 transmembrane transport GO:0055085 transport GO:0006810 |
| 4 | Q4ZJI4 | SLC9B1 | 0.62334 | homeostatic process GO:0042592 reproduction GO:0000003 transmembrane transport GO:0055085 ... |
| 5 | Q13522 | PPP1R1A | 0.62119 | carbohydrate metabolic process GO:0005975 generation of precursor metabolites and energy GO:0006091 signal transduction GO:0007165 |
| 6 | Q7Z2G1 | H2BW1 | 0.61181 | cellular component assembly GO:0022607 chromosome organization GO:0051276 protein-containing complex assembly GO:0065003 |
| 7 | A6NMN3 | FAM170B | 0.61179 | reproduction GO:0000003 |
| 8 | P22415 | USF1 | 0.60794 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 9 | A6NMS7 | LRRC37A | 0.59697 | |
| 10 | A6NM11 | LRRC37A2 | 0.5949 |
20 40 60 80 100 AA: METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTSSCPNVSERSFDNVRSLKVESGAWIGYEHTSFCGQQFILERGEYPRWDAWS STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDD.D................................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDD...DD................D..................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDD........................................................................... CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................................... RICH_[QT]: TQaeQQeleTlpTTkmaQT RICH_[E]: EtqaEqqElE RICH_[Q]: QaeQQeletlpttkmaQ RICH_[T]: TqaeqqeleTlpTTkmaqTnpT RICH_[EQ]: EtQaEQQElEtlpttkmaQ RICH_[ET]: ETqaEqqElETlpTTkmaqT RICH_MOBI_[QT]: TQaeQQeleTlpTTkmaQT RICH_MOBI_[E]: EtqaEqqElE RICH_MOBI_[Q]: QaeQQeletlpttkmaQ RICH_MOBI_[T]: TqaeqqeleTlpTTkmaqTnpT RICH_MOBI_[EM]: MEtqaEqqElEtlpttkM RICH_MOBI_[EQ]: EtQaEQQElEtlpttkmaQ RICH_MOBI_[ET]: ETqaEqqElETlpTTkmaqT RICH_MOBI_[MQ]: MetQaeQQeletlpttkMaQ RICH_MOBI_[MT]: MeTqaeqqeleTlpTTkM
120 140 160 180 200 AA: GSNAYHIERLMSFRPICSANHKESKMTIFEKENFIGRQWEISDDYPSLQAMGWFNNEVGSMKIQSGAWVCYQYPGYRGYQYILECDHHGGDYKHWREWGS STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
AA: HAQTSQIQSIRRIQQ STMI: DO_DISOPRED3: ............... DO_IUPRED2A: ............... DO_SPOTD: .............DD CONSENSUS: ............... CONSENSUS_MOBI: ...............