Q7Z2G1 H2BWT_HUMAN

Gene name: H2BW1
Protein name: Histone H2B type W-T

List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- chromosome organization GO:0051276
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O15519 CFLAR 0.67913 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biological process involved in symbiotic interaction GO:0044403
...
2 P54274 TERF1 0.65546 biosynthetic process GO:0009058
cell cycle GO:0007049
cell division GO:0051301
...
3 A6NMN3 FAM170B 0.62948 reproduction GO:0000003
4 Q9BSC4 NOL10 0.62131 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
5 P35749 MYH11 0.61974 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
6 Q0VF96 CGNL1 0.61913 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
signal transduction GO:0007165
7 Q8N573 OXR1 0.61349 cell death GO:0008219
cellular protein modification process GO:0006464
response to stress GO:0006950
8 Q99996 AKAP9 0.61281 cell cycle GO:0007049
cell-cell signaling GO:0007267
cellular component assembly GO:0022607
...
9 P22415 USF1 0.61255 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
10 P05813 CRYBA1 0.61181 anatomical structure development GO:0048856
cell death GO:0008219
cellular protein modification process GO:0006464
...

                                           20                  40                  60                  80                 100
AA:                      MLRTEVPRLPRSTTAIVWSCHLMATASAMAGPSSETTSEEQLITQEPKEANSTTSQKQSKQRKRGRHGPRRCHSNCRGDSFATYFRRVLKQVHQGLSLSR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................
DO_IUPRED2A:             DDDDDDD....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................
CONSENSUS_MOBI:          ............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................
RICH_[E]:                                                  EttsEEqlitqEpkE                                                   
RICH_[K]:                                                               KeansttsqKqsKqrK                                     
RICH_[Q]:                                                        QlitQepkeansttsQkQskQ                                       
RICH_[R]:                                                                             RkRgRhgpRR                             
RICH_[T]:                                        TasamagpsseTTseeqliT                                                        
RICH_[EQ]:                                                     EEQlitQEpkEansttsQkQ                                          
RICH_[ET]:                                                 ETTsEEqliTqEpkEansTT                                              
RICH_[HR]:                                                                            RkRgRHgpRRcH                           
RICH_[KQ]:                                                           QepKeansttsQKQsKQrK                                     
RICH_[KR]:                                                                       KqsKqRKRgR                                  
RICH_fLPS_[R]:                                                                        RkRgRhgpRR                             
RICH_MOBI_[E]:                                             EttsEEqlitqEpkE                                                   
RICH_MOBI_[K]:                                                          KeansttsqKqsKqrK                                     
RICH_MOBI_[Q]:                                                   QlitQepkeansttsQkQskQ                                       
RICH_MOBI_[R]:                                                                        RkRgRhgpRR                             
RICH_MOBI_[T]:                                              TTseeqliTqepkeansTT                                              
RICH_MOBI_[EQ]:                                                EEQlitQEpkEansttsQkQ                                          
RICH_MOBI_[ET]:                                            ETTsEEqliTqEpkEansTT                                              
RICH_MOBI_[HR]:                                                                       RkRgRHgpRRcH                           
RICH_MOBI_[KQ]:                                                      QepKeansttsQKQsKQrK                                     
RICH_MOBI_[KR]:                                                                  KqsKqRKRgR                                  
RICH_fLPS_MOBI_[R]:                                                                   RkRgRhgpRR                             

                                          120                 140                 160     
AA:                      EAVSVMDSLVHDILDRIATEAGRLARSTKRQTITAWETRMAVRLLLPGQMGKLAESEGTKAVLRTSLYAIQQQRK
STMI:                                                                                               
DO_DISOPRED3:            ......................................................................DDDDD
DO_IUPRED2A:             ....................DD.DD..DDDD........................DD..................
DO_SPOTD:                ...............................................................DDDDDDDDDDDD
CONSENSUS:               ......................................................................DDDDD
CONSENSUS_MOBI:          ...........................................................................