P06307 CCKN_HUMAN

Gene name: CCK
Protein name: Cholecystokinin

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- homeostatic process GO:0042592
- nervous system process GO:0050877
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P10253 GAA 0.9193 anatomical structure development GO:0048856
carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
...
2 Q8TAD2 IL17D 0.88438 anatomical structure development GO:0048856
immune system process GO:0002376
response to stress GO:0006950
3 Q5VT28 FAM27B 0.87716
4 P39905 GDNF 0.85543 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
5 Q92673 SORL1 0.84555 anatomical structure development GO:0048856
catabolic process GO:0009056
cell death GO:0008219
...
6 Q9BVX2 TMEM106C 0.82963
7 Q52M58 C14orf177 0.82263
8 Q9UIL4 KIF25 0.8039 catabolic process GO:0009056
cell cycle GO:0007049
cellular component assembly GO:0022607
...
9 Q8N539 FIBCD1 0.8024
10 Q6ZSR3 n/a 0.80206

                                           20                  40                  60                  80                 100
AA:                      MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGW
STMI:                    SSSSSSSSSSSSSSSSSSSS                                                                                
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................
DO_IUPRED2A:             ....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................DDDDDDDDDD..............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.D.
CONSENSUS:                                   DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................DDDDDDDDDD..............
CONSENSUS_MOBI:                              .DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................
RICH_[AP]:                                    PvPPAdPAgsglqrAeeAP                                                            
RICH_[AR]:                                        AdpAgsglqRAeeApRRqlR                                                       
RICH_[R]:                                                  RaeeapRRqlRvsqR                                                   
RICH_MOBI_[AR]:                                   AdpAgsglqRAeeApRRqlR                                                       
RICH_MOBI_[R]:                                             RaeeapRRqlRvsqR                                                   

                              
AA:                      MDFGRRSAEEYEYPS
STMI:                                   
DO_DISOPRED3:            .......DDDDDDDD
DO_IUPRED2A:             .............DD
DO_SPOTD:                ....DDDDDDDDDDD
CONSENSUS:               .......DDDDDDDD
CONSENSUS_MOBI:          ...............