Q9BVX2 T106C_HUMAN
Gene name: TMEM106C
Protein name: Transmembrane protein 106C
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9UIL4 | KIF25 | 0.93708 | catabolic process GO:0009056 cell cycle GO:0007049 cellular component assembly GO:0022607 ... |
| 2 | Q92673 | SORL1 | 0.93262 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
| 3 | Q8TAD2 | IL17D | 0.90229 | anatomical structure development GO:0048856 immune system process GO:0002376 response to stress GO:0006950 |
| 4 | Q6PK18 | OGFOD3 | 0.89517 | |
| 5 | Q8N539 | FIBCD1 | 0.89425 | |
| 6 | Q5VT28 | FAM27B | 0.88936 | |
| 7 | Q9NTM9 | CUTC | 0.86528 | cellular component assembly GO:0022607 homeostatic process GO:0042592 protein-containing complex assembly GO:0065003 ... |
| 8 | Q52M58 | C14orf177 | 0.86484 | |
| 9 | P39905 | GDNF | 0.86167 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 10 | A0A1B0GTQ4 | MYMX | 0.8512 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MGSQHSAAARPSSCRRKQEDDRDGLLAEREQEEAIAQFPYVEFTGRDSITCLTCQGTGYIPTEQVNELVALIPHSDQRLRPQRTKQYVLLSILLCLLASG STMI: MMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................................... DO_IUPRED2A: DDD..DDDDDDDDDD...DDDDDDDDD......................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDD............................................................. RICH_[AR]: AAARpsscRR RICH_[R]: RpsscRRkqeddRdgllaeR RICH_MOBI_[AR]: AAARpsscRR RICH_MOBI_[R]: RpsscRRkqeddR
120 140 160 180 200 AA: LVVFFLFPHSVLVDDDGIKVVKVTFNKQDSLVILTIMATLKIRNSNFYTVAVTSLSSQIQYMNTVVSTYVTTNVSLIPPRSEQLVNFTGKAEMGGPFSYV STMI: MMMMMMM MMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ......................................................................................... CONSENSUS_MOBI: .........................................................................................
220 240 AA: YFFCTVPEILVHNIVIFMRTSVKISYIGLMTQSSLETHHYVDCGGNSTAI STMI: MMMMMMMMMMMMMMMMM DO_DISOPRED3: ................................................DD DO_IUPRED2A: .................................................. DO_SPOTD: ..............................................DDDD CONSENSUS: ...............................DD CONSENSUS_MOBI: .................................