P09693 CD3G_HUMAN
Gene name: CD3G
Protein name: T-cell surface glycoprotein CD3 gamma chain
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- cell differentiation GO:0030154
- cellular component assembly GO:0022607
- immune system process GO:0002376
- membrane organization GO:0061024
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- signal transduction GO:0007165
- transport GO:0006810
- vesicle-mediated transport GO:0016192
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P04234 | CD3D | 0.76624 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 2 | Q0P6D6 | CCDC15 | 0.62085 | |
| 3 | Q9UK12 | ZNF222 | 0.61412 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 4 | P43630 | KIR3DL2 | 0.59264 | cell death GO:0008219 immune system process GO:0002376 response to stress GO:0006950 |
| 5 | Q9BVV2 | FNDC11 | 0.57364 | |
| 6 | Q7Z5Y7 | KCTD20 | 0.5478 | |
| 7 | P42892 | ECE1 | 0.52752 | anatomical structure development GO:0048856 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | O75558 | STX11 | 0.50787 | cell-cell signaling GO:0007267 membrane organization GO:0061024 protein transport GO:0015031 ... |
| 9 | A4D256 | CDC14C | 0.50586 | cell cycle GO:0007049 cell division GO:0051301 cellular component assembly GO:0022607 ... |
| 10 | Q9Y4G6 | TLN2 | 0.49325 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
20 40 60 80 100 AA: MEQGKGLAVLILAIILLQGTLAQSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVY STMI: SSSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................... DO_IUPRED2A: ....................................................................................DDDD............ DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ CONSENSUS: DD............................................................................ CONSENSUS_MOBI: ..............................................................................
120 140 160 180 AA: YRMCQNCIELNAATISGFLFAEIVSIFVLAVGVYFIAGQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRN STMI: MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: .......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ..............................................DDD........DDD....D.....DDDDDDDD...D DO_SPOTD: .......................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: ................ ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ................ ............................................. RICH_[QY]: QlYQplkdreddQYshlQgnQ RICH_[D]: DkqtllpnDqlyqplkDreDD RICH_[Q]: QsrasdkQtllpndQlyQ RICH_[DL]: DkqtLLpnDqLyqpLkDreDD RICH_[DQ]: QtllpnDQlyQplkDreDDQ RICH_[DY]: DqlYqplkDreDDqY RICH_[LQ]: QsrasdkQtLLpndQLyQpL RICH_[LY]: LLpndqLYqpLkdreddqY