P04234 CD3D_HUMAN

Gene name: CD3D
Protein name: T-cell surface glycoprotein CD3 delta chain

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- immune system process GO:0002376
- membrane organization GO:0061024
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UK12 ZNF222 0.85427 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
2 P43630 KIR3DL2 0.82534 cell death GO:0008219
immune system process GO:0002376
response to stress GO:0006950
3 Q9BVV2 FNDC11 0.79082
4 P09693 CD3G 0.76624 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
5 Q0P6D6 CCDC15 0.76347
6 A6NJ78 METTL15 0.70209 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
7 A4D256 CDC14C 0.70133 cell cycle GO:0007049
cell division GO:0051301
cellular component assembly GO:0022607
...
8 Q13277 STX3 0.65387 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
9 P13010 XRCC5 0.6462 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
10 P30279 CCND2 0.6127 cell cycle GO:0007049
cell death GO:0008219
cell division GO:0051301
...

                                           20                  40                  60                  80                 100
AA:                      MEHSTFLSGLVLATLLSQVSPFKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELD
STMI:                    SSSSSSSSSSSSSSSSSSSSS                                                                               
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDD.................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DD..................................................................................................
CONSENSUS:                                    ...............................................................................
CONSENSUS_MOBI:                               .....................................................DDDDDDDD.............DDDDD

                                          120                 140                 160         
AA:                      PATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
STMI:                         MMMMMMMMMMMMMMMMMMMMM                                             
DO_DISOPRED3:            ............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .......................................................................
DO_SPOTD:                ............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .....                     ..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .....                     .............................................
RICH_[QY]:                                                             QvYQplrdrddaQY           
RICH_[D]:                                                     DtqallrnDqvyqplrDrDD              
RICH_[Q]:                                                       QallrndQvyQplrdrddaQ            
RICH_[DQ]:                                                      QallrnDQvyQplrDrDDaQ            
RICH_[DY]:                                                            DqvYqplrDrDDaqY