P0C5K6 CT18_HUMAN

Gene name: VENTXP1
Protein name: Putative tumor antigen NA88-A

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q15436 SEC23A 0.93888 cellular component assembly GO:0022607
immune system process GO:0002376
membrane organization GO:0061024
...
2 Q99062 CSF3R 0.83205 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
3 Q9GZQ4 NMUR2 0.79612 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
homeostatic process GO:0042592
...
4 Q9NP58 ABCB6 0.78935 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
5 P35228 NOS2 0.78633 biosynthetic process GO:0009058
catabolic process GO:0009056
cell population proliferation GO:0008283
...
6 Q9NWZ3 IRAK4 0.78488 cell population proliferation GO:0008283
cellular protein modification process GO:0006464
immune system process GO:0002376
...
7 O00180 KCNK1 0.74901 circulatory system process GO:0003013
transmembrane transport GO:0055085
transport GO:0006810
8 P16473 TSHR 0.74126 cell population proliferation GO:0008283
cell-cell signaling GO:0007267
homeostatic process GO:0042592
...
9 Q92959 SLCO2A1 0.71202 transport GO:0006810
10 Q9NWS0 PIH1D1 0.70711 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...

                                           20       
AA:                      MSPPSSMCSPVPLLAAASGQNRMTQGQHFLQKV
STMI:                                                     
DO_DISOPRED3:            DDD..............................
DO_IUPRED2A:             DDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .................................
RICH_[Q]:                                   QnrmtQgQhflQ