Q9NWS0 PIHD1_HUMAN
Gene name: PIH1D1
Protein name: PIH1 domain-containing protein 1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell differentiation GO:0030154
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- chromosome organization GO:0051276
- homeostatic process GO:0042592
- protein-containing complex assembly GO:0065003
- ribonucleoprotein complex assembly GO:0022618
- ribosome biogenesis GO:0042254
- signal transduction GO:0007165
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q9NWS0 | PIH1D1 | 1 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
2 | P62280 | RPS11 | 0.99941 |
biological process involved in symbiotic interaction
GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
3 | Q8N8J6 | ZNF615 | 0.85749 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
4 | Q9H1L0 | MIR1-1HG | 0.70711 | |
5 | Q9UK13 | ZNF221 | 0.70711 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
6 | A8MTZ0 | BBIP1 | 0.6872 |
cellular component assembly
GO:0022607 protein transport GO:0015031 transport GO:0006810 |
7 | Q15436 | SEC23A | 0.66389 |
cellular component assembly
GO:0022607 immune system process GO:0002376 membrane organization GO:0061024 ... |
8 | Q9Y5C1 | ANGPTL3 | 0.65673 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 carbohydrate metabolic process GO:0005975 ... |
9 | Q96MR6 | CFAP57 | 0.65072 | |
10 | Q13163 | MAP2K5 | 0.64378 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
20 40 60 80 100
AA: MANPKLLGMGLSEAEAIGADSARFEELLLQASKELQQAQTTRPESTQIQPQPGFCIKTNSSEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAGFRIP
STMI:
DO_DISOPRED3: DDDDDDDDDDDDD..DD...................................................................................
DO_IUPRED2A: ....DD...DDDD...................DDDDDDDDDDDDDDDDDDDDDDD......................DDDDDDDDDDD.........DDD
DO_SPOTD: DDDDDDDDDDDDDDDDDD..................................................................................
CONSENSUS: DDDDDDDDDDDDDDDDD...................................................................................
CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 200
AA: MSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRELVITIAREGLEDKYNLQLNPEWRMMKNRPFMGSISQQNIRSEQRPRIQELGDLYTPAPGR
STMI:
DO_DISOPRED3: .......................................................................................D.....DDDDDDD
DO_IUPRED2A: DDDDDD.DDDDD............................................................DDDDDDD.DDD.DDDDDDDDDDDDDDDD
DO_SPOTD: ...........................................................................DDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS: ...........................................................................DDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI: ..................................................................................................DD
RICH_[Q]: QQnirseQrpriQ
RICH_[IQ]: QQnIrseQrprIQ
220 240 260 280
AA: AESGPEKPHLNLWLEAPDLLLAEVDLPKLDGALGLSLEIGENRLVMGGPQQLYHLDAYIPLQINSHESKAAFHRKRKQLMVAMPLLPVPS
STMI:
DO_DISOPRED3: D........................................................................................D
DO_IUPRED2A: DD..DDDD.................................................................D................
DO_SPOTD: DDDDDDDD.................................................................................D
CONSENSUS: DDDDDDDD.................................................................................D
CONSENSUS_MOBI: DD........................................................................................