P0C7Q2 ARMS2_HUMAN
Gene name: ARMS2
Protein name: Age-related maculopathy susceptibility protein 2
List of terms from Generic GO subset, which this protein is a part of:
- homeostatic process GO:0042592
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96AM1 | MRGPRF | 0.96373 | signal transduction GO:0007165 |
| 2 | Q96GR2 | ACSBG1 | 0.89532 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | P55212 | CASP6 | 0.82231 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 4 | Q8TDB8 | SLC2A14 | 0.77403 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 ... |
| 5 | Q9UI15 | TAGLN3 | 0.76363 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 6 | P0DPA3 | SNHG28 | 0.72321 | |
| 7 | P41743 | PRKCI | 0.71954 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 8 | Q9UGH3 | SLC23A2 | 0.6917 | carbohydrate metabolic process GO:0005975 cellular nitrogen compound metabolic process GO:0034641 response to stress GO:0006950 ... |
| 9 | Q9P1Z9 | CCDC180 | 0.63723 | |
| 10 | Q96J01 | THOC3 | 0.61644 |
20 40 60 80 100 AA: MLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAKIHTELCLPAFFSPAGTQRRFQQPQHHLTLS STMI: DO_DISOPRED3: DDD.DDDDDDDDD....................................................................................... DO_IUPRED2A: ........DDDDDDDDDDDDDD.....................DDDDDDDDDDDDDDDDD...........................D...DD....... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDD.....................DDDDDDDDDDDDDDDDD........................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDD............................................................................... RICH_MOBI_[GM]: MlrlypGpMvteaeGkGGpeM
AA: IIHTAAR STMI: DO_DISOPRED3: .....DD DO_IUPRED2A: ....... DO_SPOTD: .....DD CONSENSUS: .....DD CONSENSUS_MOBI: .......