Q9UI15 TAGL3_HUMAN
Gene name: TAGLN3
Protein name: Transgelin-3
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P55212 | CASP6 | 0.85328 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 |
| 2 | P0C7Q2 | ARMS2 | 0.76363 | homeostatic process GO:0042592 |
| 3 | Q96AM1 | MRGPRF | 0.73593 | signal transduction GO:0007165 |
| 4 | Q9UGH3 | SLC23A2 | 0.69987 | carbohydrate metabolic process GO:0005975 cellular nitrogen compound metabolic process GO:0034641 response to stress GO:0006950 ... |
| 5 | P09131 | SLC10A3 | 0.69285 | transport GO:0006810 |
| 6 | Q96F15 | GIMAP5 | 0.68749 | |
| 7 | P41743 | PRKCI | 0.68683 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell death GO:0008219 ... |
| 8 | Q96GR2 | ACSBG1 | 0.68369 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | Q96DX5 | ASB9 | 0.68008 | catabolic process GO:0009056 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 10 | Q9BUW7 | C9orf16 | 0.64833 |
20 40 60 80 100 AA: MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAA STMI: DO_DISOPRED3: DDDDD............................................................................................... DO_IUPRED2A: ......D..........................................D.............................DDD.................. DO_SPOTD: DDDDDDDD............................................................................................ CONSENSUS: DDDDDDD............................................................................................. CONSENSUS_MOBI: ....................................................................................................
120 140 160 180 AA: ETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIM STMI: DO_DISOPRED3: ...................................................................................DDD.D........... DO_IUPRED2A: ...............................................DDDD...DDDD..DDDDDDD.....DDDD.DDDD...DDDDDDD........ DO_SPOTD: .....................................................DDDDDDDD...................DDDDDDDDDDDDDDDDDDD CONSENSUS: ......................................................DDDDDDD...................DDDDDDDDDDD........ CONSENSUS_MOBI: ...........................................................................DDDDDDDDDDDDDDDDDDDDDDDD RICH_MOBI_[G]: GsnkGasqaGmtGyG RICH_MOBI_[M]: MtgygMprqiM RICH_MOBI_[GM]: MGsnkGasqaGMtGyGMprqiM