P0C7U1 ASA2B_HUMAN
Gene name: ASAH2B
Protein name: Putative inactive neutral ceramidase B
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cellular nitrogen compound metabolic process GO:0034641
- small molecule metabolic process GO:0044281
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q9P2B2 | PTGFRN | 0.76822 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
2 | Q5EB52 | MEST | 0.70711 |
anatomical structure development
GO:0048856 |
3 | Q49AS3 | LRRC37A5P | 0.57735 | |
4 | O60243 | HS6ST1 | 0.57637 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
5 | Q9UBX8 | B4GALT6 | 0.43601 |
anatomical structure development
GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
6 | Q08462 | ADCY2 | 0.38912 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
7 | Q6ZTQ3 | RASSF6 | 0.37857 |
cell death
GO:0008219 signal transduction GO:0007165 |
8 | Q86VH4 | LRRTM4 | 0.37796 | |
9 | O75762 | TRPA1 | 0.37259 |
cellular component assembly
GO:0022607 nervous system process GO:0050877 protein-containing complex assembly GO:0065003 ... |
10 | Q96ES7 | SGF29 | 0.33672 |
cellular protein modification process
GO:0006464 chromosome organization GO:0051276 |
20 40 60 80 100
AA: MRQHRQFMDRTHYLLTFSSSETLLRLLLRIVDRAPKGRTFGDVLQPAKPEYRVGEVAEVIFVGANPKNSVQNQTHQTFLTVEKYEATSTSWQIVCNDASW
STMI:
DO_DISOPRED3: DDDDDDDDDDDDDDDDDD..................................................................................
DO_IUPRED2A: ........................................................................D...........................
DO_SPOTD: DDDDDDDDDD..........................................................................................
CONSENSUS: DDDDDDDDDD..........................................................................................
CONSENSUS_MOBI: ....................................................................................................
RICH_[MR]: MRqhRqfMdR
120 140 160
AA: ETRFYWHKGLLGLSNATVEWHIPDTAQPGIYRIRYFGHNRKQDILKPAVILSFEGTSPAFEVVTI
STMI:
DO_DISOPRED3: .................................................................
DO_IUPRED2A: .................................................................
DO_SPOTD: .................................................................
CONSENSUS: .................................................................
CONSENSUS_MOBI: .................................................................