Q49AS3 L37A5_HUMAN

Gene name: LRRC37A5P
Protein name: Putative protein LRRC37A5P

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O60243 HS6ST1 0.9983 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
2 Q08462 ADCY2 0.82374 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
3 Q9NUL7 DDX28 0.8165 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
ribonucleoprotein complex assembly GO:0022618
...
4 P33681 CD80 0.81383 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
5 Q9P2B2 PTGFRN 0.81314 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
6 O60762 DPM1 0.8115 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
small molecule metabolic process GO:0044281
7 Q9Y3A4 RRP7A 0.80964 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cellular component assembly GO:0022607
...
8 P50749 RASSF2 0.75996 anatomical structure development GO:0048856
cell cycle GO:0007049
cell death GO:0008219
...
9 Q15036 SNX17 0.74407 anatomical structure development GO:0048856
catabolic process GO:0009056
protein transport GO:0015031
...
10 Q9H0I3 CCDC113 0.73887 cellular component assembly GO:0022607

                                           20                  40                  60                  80                 100
AA:                      MNRNILEEMLQYLLIDWIVGDQFEIQLNQQLWSLIPNNDVRRLVSHVIRTLKTDCTETHLQLACAKLISRTGLLMKLLSEQQELRTVSMTAWKPRMNRKS
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDD.................................................................................DDDDDD
DO_IUPRED2A:             .................................................................................................DDD
DO_SPOTD:                DDDDDDDD.........................................................................DDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDD......................................................................................DDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[R]:                                                                                                              RmnRks
RICH_[MR]:                                                                                                             RMnRks
RICH_fLPS_[R]:                                                                                                         RmnRks

                                       
AA:                      RSRMRS
STMI:                          
DO_DISOPRED3:            DDDDDD
DO_IUPRED2A:             DDDDDD
DO_SPOTD:                DDDDDD
CONSENSUS:               DDDDDD
CONSENSUS_MOBI:          ......
RICH_[R]:                RsRmR 
RICH_[MR]:               RsRMR 
RICH_fLPS_[R]:           RsRmR