P0CW23 AKAI1_HUMAN

Gene name: AKAIN1
Protein name: A-kinase anchor protein inhibitor 1

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UQF0 ERVW-1 0.93513 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
2 O15072 ADAMTS3 0.87145 anatomical structure development GO:0048856
biosynthetic process GO:0009058
catabolic process GO:0009056
...
3 P10644 PRKAR1A 0.86214 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
4 Q9UGN4 CD300A 0.85013 cell adhesion GO:0007155
cell population proliferation GO:0008283
cellular protein modification process GO:0006464
...
5 Q5T686 AVPI1 0.82922 cell cycle GO:0007049
cellular protein modification process GO:0006464
signal transduction GO:0007165
6 Q6ZVN7 SEM1 0.81027 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
DNA metabolic process GO:0006259
...
7 O75603 GCM2 0.8062 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
8 Q8WZB0 LINC00476 0.73102
9 Q5XG85 n/a 0.69311
10 Q6QEF8 CORO6 0.69231 cytoskeleton organization GO:0007010

                                           20                  40                  60           
AA:                      MVFAPGEKPGNEPEEVKLQNASKQIVQNAILQAVQQVSQESQRREERISDNRDHIQLGVGELTKKHEKK
STMI:                                                                                         
DO_DISOPRED3:            DD.D.........................................DDDDDDDDD....DDD.....DDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDD............DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDD.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDD.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[R]:                                                          RReeRisdnR                 
RICH_MOBI_[R]:                                                     RReeRisdnR                 
RICH_MOBI_[IR]:                                                    RReeRIsdnRdhI