Q5XG85 U633C_HUMAN
Protein name: Putative UPF0633 protein LOC554249
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | Q6QEF8 | CORO6 | 0.99884 |
cytoskeleton organization
GO:0007010 |
2 | Q96NB1 | CEP20 | 0.99746 |
cellular component assembly
GO:0022607 cytoskeleton organization GO:0007010 |
3 | Q9NRA2 | SLC17A5 | 0.99352 |
transport
GO:0006810 |
4 | A8MTB9 | CEACAM18 | 0.98995 | |
5 | Q9NRC8 | SIRT7 | 0.98824 |
biosynthetic process
GO:0009058 carbohydrate metabolic process GO:0005975 cell cycle GO:0007049 ... |
6 | Q9BT56 | SPX | 0.97208 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 circulatory system process GO:0003013 ... |
7 | Q8IYR6 | TMEFF1 | 0.95917 |
anatomical structure development
GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ... |
8 | A0A1B0GTQ4 | MYMX | 0.95802 |
anatomical structure development
GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ... |
9 | Q8TAU3 | ZNF417 | 0.93272 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
10 | Q96SQ5 | ZNF587 | 0.93011 |
biosynthetic process
GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
20 40 60 80
AA: MRKLRLRASNPGPSGAPGTRRHFSTSRGGHHCARRWLRRVRRSRSQTPSCQNLDPNPPIARFLLPLERISEVPRRACLHGRDASSVWPPPERSD
STMI:
DO_DISOPRED3: DDDDDDDDDDDDDDDDDD........................................................................DDDD
DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDDDDD..DDDDDDDDDDDDDDDDD..D..DD.........D....DDDDDDDDDDDDDDD
DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDD.DDD......................................................DDDDDD..DDDDDD
CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDD......................................................DDDDDDDDDDDDDD
CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................
RICH_[R]: RklRlRasnpgpsgapgtRR
RICH_MOBI_[R]: RklRlRasnpgpsgapgtRR