List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q6QEF8	CORO6	0.99884	cytoskeleton organization GO:0007010
2	Q96NB1	CEP20	0.99746	cellular component assembly GO:0022607 cytoskeleton organization GO:0007010
3	Q9NRA2	SLC17A5	0.99352	transport GO:0006810
4	A8MTB9	CEACAM18	0.98995
5	Q9NRC8	SIRT7	0.98824	biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell cycle GO:0007049 ...
6	Q9BT56	SPX	0.97208	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 circulatory system process GO:0003013 ...
7	Q8IYR6	TMEFF1	0.95917	anatomical structure development GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ...
8	A0A1B0GTQ4	MYMX	0.95802	anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ...
9	Q8TAU3	ZNF417	0.93272	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641
10	Q96SQ5	ZNF587	0.93011	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80      
AA:                      MRKLRLRASNPGPSGAPGTRRHFSTSRGGHHCARRWLRRVRRSRSQTPSCQNLDPNPPIARFLLPLERISEVPRRACLHGRDASSVWPPPERSD
STMI:                                                                                                                  
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDD........................................................................DDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDDDDD..DDDDDDDDDDDDDDDDD..D..DD.........D....DDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDD.DDD......................................................DDDDDD..DDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDD......................................................DDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................
RICH_[R]:                 RklRlRasnpgpsgapgtRR                                                                         
RICH_MOBI_[R]:            RklRlRasnpgpsgapgtRR