P0DKB6 MPC1L_HUMAN

Gene name: MPC1L
Protein name: Mitochondrial pyruvate carrier 1-like protein

List of terms from Generic GO subset, which this protein is a part of:
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8N8R3 SLC25A29 0.99269 transmembrane transport GO:0055085
transport GO:0006810
2 Q96I15 SCLY 0.97709 small molecule metabolic process GO:0044281
3 P51817 PRKX 0.93588 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
4 Q9UFC0 LRWD1 0.92899 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
...
5 P10415 BCL2 0.91375 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
6 P0DKB5 TPBGL 0.91104
7 Q01581 HMGCS1 0.90317 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
8 P57086 SCAND1 0.8945
9 Q96BN8 OTULIN 0.88314 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
10 Q9BYE2 TMPRSS13 0.8515

                                           20                  40                  60                  80                 100
AA:                      MARMAVLWRKMRDNFQSKEFREYVSSTHFWGPAFSWGLPLAAFKDMKASPEIISGRMTTALILYSAIFMRFAYRVQPRNLLLMACHCTNVMAQSVQASRY
STMI:                                       MMMMMMMMMMMMMMMMMMMMMMM         MMMMMMMMMMMMMMMMMMMMMMM                          
DO_DISOPRED3:            DDDDDDDDDDD.........................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DD..................................................................................................
CONSENSUS:               DD.................                       .........                       ..........................
CONSENSUS_MOBI:          ...................                       .........                       ..........................

                                          120    
AA:                      LLYYYGGGGAEAKARDPPATAAAATSPGSQPPKQAS
STMI:                                                        
DO_DISOPRED3:            ............DDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ...............DDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ............DDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..........DDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[AP]:                            ArdPPAtAAAAtsPgsqPPkqA 
RICH_[A]:                             ArdppAtAAAA            
RICH_fLPS_[A]:                       kArdppAtAAAAtsp         
RICH_MOBI_[A]:                      AkArdppAtAAAA            
RICH_fLPS_MOBI_[A]:                eAkArdppAtAAAAtspgsq