P10415 BCL2_HUMAN

Gene name: BCL2
Protein name: Apoptosis regulator Bcl-2

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell adhesion GO:0007155
- cell cycle GO:0007049
- cell death GO:0008219
- cell differentiation GO:0030154
- cell junction organization GO:0034330
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- developmental maturation GO:0021700
- growth GO:0040007
- homeostatic process GO:0042592
- immune system process GO:0002376
- membrane organization GO:0061024
- mitotic cell cycle GO:0000278
- protein transport GO:0015031
- reproduction GO:0000003
- response to stress GO:0006950
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8N8R3 SLC25A29 0.92044 transmembrane transport GO:0055085
transport GO:0006810
2 Q6ZVX9 PAQR9 0.91921
3 P57086 SCAND1 0.91462
4 P0DKB6 MPC1L 0.91375 transmembrane transport GO:0055085
transport GO:0006810
5 Q96I15 SCLY 0.89284 small molecule metabolic process GO:0044281
6 P0DKB5 TPBGL 0.87467
7 Q9BYE2 TMPRSS13 0.87032
8 P51817 PRKX 0.86907 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
9 Q9UFC0 LRWD1 0.86674 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
...
10 Q53GA4 PHLDA2 0.85163 anatomical structure development GO:0048856
carbohydrate metabolic process GO:0005975
cell death GO:0008219
...

                                           20                  40                  60                  80                 100
AA:                      MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQA
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............
DO_IUPRED2A:             DDDDD.D........................DDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD................
DO_SPOTD:                DDDDDDDD......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............
CONSENSUS:               DDDDDDDD......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............
CONSENSUS_MOBI:          ..................................DDDDDDDDDDDDDDD.................DDDDDDDDDDDDDDDDDDDD..............
RICH_[AG]:                                              AGdvGAAppGAApApG                                                     
RICH_[AP]:                                              AgdvgAAPPgAAPAPgifssqPghtP  AAsrdPvArtsPlqtPAAPgAAAgPA               
RICH_[A]:                                               AgdvgAAppgAApA                     ArtsplqtpAApgAAAgpA               
RICH_[P]:                                                      PPgaaPaPgifssqPghtPhP                                         
RICH_[GP]:                                               GdvGaaPPGaaPaPG                                                     
RICH_fLPS_[A]:                                         dAgdvgAAppgAApA                    vArtsplqtpAApgAAAgpA               
RICH_MOBI_[AP]:                                              AAPPgAAPAP                                                      
RICH_MOBI_[A]:                                                                             ArtsplqtpAApgAAAgpA               
RICH_fLPS_MOBI_[A]:                                                                        ArtsplqtpAApgAAAgpAl              

                                          120                 140                 160                 180                 200
AA:                      GDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVE
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          220 
AA:                      LYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK
STMI:                               MMMMMMMMMMMMMMMMMMMMMM      
DO_DISOPRED3:            ...............DDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             .......................................
DO_SPOTD:                .....................................DD
CONSENSUS:               ...........                      ....DD
CONSENSUS_MOBI:          ...........                      ......