P0DO92 ENOL_HUMAN

Gene name: CDIPTOSP
Protein name: Putative protein T-ENOL

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q13163 MAP2K5 0.89851 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
2 Q9NUX5 POT1 0.82531 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
3 Q9H2U2 PPA2 0.82531 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
...
4 Q9UHX3 ADGRE2 0.82531 cell adhesion GO:0007155
immune system process GO:0002376
response to stress GO:0006950
...
5 Q02363 ID2 0.74565 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
6 Q8TAG5 VSTM2A 0.74514 cell differentiation GO:0030154
cell population proliferation GO:0008283
7 P15907 ST6GAL1 0.74291 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
8 Q16445 GABRA6 0.73818 cell-cell signaling GO:0007267
nervous system process GO:0050877
signal transduction GO:0007165
...
9 P41586 ADCYAP1R1 0.73818 anatomical structure development GO:0048856
biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
...
10 Q9NPH3 IL1RAP 0.73456 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...

                                           20                  40                  60                  80                 
AA:                      MASTPMGNEGEKKSSWPSQAAPSLRGGPASLSRSEEYLSQISAELMEEALCTACCHLNPVPIKKKQSQDQATQISKRAFFTKT
STMI:                                                                                                       
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDD..................................................D.....DD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................DD.DDDDD.D.DDDDD......
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................DDDDDDDDDDDDDDDD....DD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................
RICH_[S]:                             SSwpSqaapSlrggpaSlS                                                   
RICH_[IQ]:                                                                            IkkkQsQdQatQI