Q02363 ID2_HUMAN

Gene name: ID2
Protein name: DNA-binding protein inhibitor ID-2

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- circulatory system process GO:0003013
- developmental maturation GO:0021700
- embryo development GO:0009790
- homeostatic process GO:0042592
- immune system process GO:0002376
- mitotic cell cycle GO:0000278
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O15146 MUSK 0.90348 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
2 Q9NUX5 POT1 0.90348 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
3 Q9UHX3 ADGRE2 0.90348 cell adhesion GO:0007155
immune system process GO:0002376
response to stress GO:0006950
...
4 Q8TAG5 VSTM2A 0.81572 cell differentiation GO:0030154
cell population proliferation GO:0008283
5 P15907 ST6GAL1 0.81328 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
cellular protein modification process GO:0006464
...
6 Q16445 GABRA6 0.8081 cell-cell signaling GO:0007267
nervous system process GO:0050877
signal transduction GO:0007165
...
7 Q9NPH3 IL1RAP 0.80414 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
8 Q7Z7C7 STRA8 0.80249 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
9 P59773 MINAR2 0.78979
10 P28336 NMBR 0.78765 signal transduction GO:0007165

                                           20                  40                  60                  80                 100
AA:                      MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVSKMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASR
STMI:                                                                                                                        
DO_DISOPRED3:            ..D.DD.DDDDDDDDDDDDDDDD.............................................................DDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..............DD.DDDDDDD.............................................................DDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................DDDDDDDDDDDDDDDDD
CONSENSUS:               ..DDDDDDDDDDDDDDDDDDDDDD............................................................DDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................................................
RICH_[S]:                    SpvrSvrknSlSdhSlgiS                                                                             

                                          120      
AA:                      TPLTTLNTDISILSLQASEFPSELMSNDSKALCG
STMI:                                                      
DO_DISOPRED3:            DDDDDDDDD.DDDDDDDDDDDDDDDDDDDDD..D
DO_IUPRED2A:             DD................................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..................................
RICH_[S]:                          SilSlqaSefpSelmSndS     
RICH_[IL]:                    LntdIsILsL                   
RICH_[LT]:               TpLTTLnTdisiLsL