P11686 PSPC_HUMAN
Gene name: SFTPC
Protein name: Pulmonary surfactant-associated protein C
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q6NT16 | SLC18B1 | 0.50033 | |
| 2 | Q08828 | ADCY1 | 0.47722 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 3 | O95935 | TBX18 | 0.46024 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 4 | Q5BJD5 | TMEM41B | 0.45181 | anatomical structure development GO:0048856 catabolic process GO:0009056 cellular component assembly GO:0022607 |
| 5 | Q96EL3 | MRPL53 | 0.4459 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 6 | Q05048 | CSTF1 | 0.43758 | |
| 7 | O75564 | JRK | 0.43376 | cell-cell signaling GO:0007267 signal transduction GO:0007165 |
| 8 | A6NHR9 | SMCHD1 | 0.4284 | anatomical structure development GO:0048856 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | Q9BZ76 | CNTNAP3 | 0.42765 | cell adhesion GO:0007155 |
| 10 | Q96J87 | CELF6 | 0.42057 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
20 40 60 80 100 AA: MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTG STMI: DO_DISOPRED3: DDDDDDDDDDDD..................DDD.DDDDDDDDDDDDDDDDD................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDD..D..........D.DDDD...D....DDDDDDDDDD..................................................... CONSENSUS: DDDDDDDDDD......................D....DDDDDDDDDD..................................................... CONSENSUS_MOBI: ..........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD.............. RICH_[IV]: IVVVVVVlIV RICH_fLPS_[V]: iVVVVVVliV RICH_MOBI_[M]: MsqkhteMvleM RICH_MOBI_[HM]: HMsqkHteMvleM RICH_fLPS_MOBI_[M]: hMsqkhteMvleMsi
120 140 160 180 AA: LVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI STMI: DO_DISOPRED3: ................................................................................................. DO_IUPRED2A: ..........................................................DDDDDDDDDDDD.D......................... DO_SPOTD: ..............................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................... CONSENSUS: ..........................................................DDDDDDDDDDDDDD......................... CONSENSUS_MOBI: ...................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDD.................. RICH_MOBI_[AG]: GqAeGrdAGsApsGGdpA RICH_MOBI_[G]: GqaeGrdaGsapsGG