P12018 VPREB_HUMAN

Gene name: VPREB1
Protein name: Immunoglobulin iota chain

List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q15109 AGER 0.95631 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
2 Q9BY78 RNF26 0.87751 cellular protein modification process GO:0006464
immune system process GO:0002376
response to stress GO:0006950
3 Q8TEQ8 PIGO 0.86422 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
4 O95461 LARGE1 0.82643 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular protein modification process GO:0006464
...
5 Q99418 CYTH2 0.81485 cytoskeleton organization GO:0007010
signal transduction GO:0007165
transport GO:0006810
...
6 Q8IZC7 ZNF101 0.73756 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
7 O95972 BMP15 0.73669 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
8 O00168 FXYD1 0.7235 cellular protein modification process GO:0006464
circulatory system process GO:0003013
transmembrane transport GO:0055085
...
9 Q9BRK5 SDF4 0.71558 anatomical structure development GO:0048856
cell differentiation GO:0030154
transport GO:0006810
...
10 P41181 AQP2 0.70958 anatomical structure development GO:0048856
cellular component assembly GO:0022607
homeostatic process GO:0042592
...

                                           20                  40                  60                  80                 100
AA:                      MSWAPVLLMLFVYCTGCGPQPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYL
STMI:                    SSSSSSSSSSSSSSSSSSS                                                                                 
DO_DISOPRED3:            D...................................................................................................
DO_IUPRED2A:             ...........................D...................................................DDDDDDDDDD.........DD
DO_SPOTD:                ....DDDDDDDDDDDDDD.....DDDDDDD......................................................................
CONSENSUS:                                  ........D........................................................................
CONSENSUS_MOBI:                             .................................................................................

                                          120                 140               
AA:                      SISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPTAARTRVP
STMI:                                                                 
DO_DISOPRED3:            .......................DDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ...............DDDDD...DDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                ....................DDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .......................DDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ..............................DDDDDDDDDDDDDDD
RICH_[E]:                                        EErErEwEEEmE         
RICH_[R]:                                          ReReweeemeptaaRtR  
RICH_[ER]:                                       EEREREwEEEmEptaaRtR  
RICH_fLPS_[E]:                                  kEErErEwEEEmEptaartr