O00168 PLM_HUMAN

Gene name: FXYD1
Protein name: Phospholemman

List of terms from Generic GO subset, which this protein is a part of:
- cellular protein modification process GO:0006464
- circulatory system process GO:0003013
- transmembrane transport GO:0055085
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P41181 AQP2 0.99679 anatomical structure development GO:0048856
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
2 Q13393 PLD1 0.99376 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular component assembly GO:0022607
...
3 O95972 BMP15 0.98995 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
4 Q8IZC7 ZNF101 0.98551 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
5 Q96NF6 C8orf49 0.89379
6 Q9GZY8 MFF 0.84968 anatomical structure development GO:0048856
cell death GO:0008219
protein targeting GO:0006605
...
7 Q9BY78 RNF26 0.82713 cellular protein modification process GO:0006464
immune system process GO:0002376
response to stress GO:0006950
8 Q7Z3Z2 RD3 0.808 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...
9 O95461 LARGE1 0.80254 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular protein modification process GO:0006464
...
10 Q9HBV1 POPDC3 0.8 anatomical structure development GO:0048856
cell differentiation GO:0030154

                                           20                  40                  60                  80        
AA:                      MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR
STMI:                    SSSSSSSSSSSSSSSSSSSS               MMMMMMMMMMMMMMMMMMMMM                                    
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDD...................................................DDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ..................................................................DDD.DDDDDDDDDDDDD.........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDD.........DD.DDDDDDDD..........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                   DD.............                     ..........DDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                              ...............                     ....................................
RICH_[R]:                                                                                    RtgepdeeegtfRssiRRlstRRR
RICH_[ER]:                                                                                   RtgEpdEEEgtfRssiRR