P15516 HIS3_HUMAN

Gene name: HTN3
Protein name: Histatin-3

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- immune system process GO:0002376
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8NEC5 CATSPER1 0.68467 anatomical structure development GO:0048856
cell differentiation GO:0030154
reproduction GO:0000003
...
2 A2AJT9 BCLAF3 0.47752 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 Q8TE60 ADAMTS18 0.46525 anatomical structure development GO:0048856
cell adhesion GO:0007155
response to stress GO:0006950
4 Q9H4R4 NCOR1P1 0.46311 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
5 Q92901 RPL3L 0.43253 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
6 P0DN25 C1GALT1C1L 0.42636 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
7 Q92504 SLC39A7 0.42594 homeostatic process GO:0042592
transmembrane transport GO:0055085
transport GO:0006810
8 Q6UXD1 HRCT1 0.42465
9 Q969G9 NKD1 0.42278 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
catabolic process GO:0009056
...
10 Q15415 RBMY1F 0.41999 cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
reproduction GO:0000003

                                           20                  40         
AA:                      MKFFVFALILALMLSMTGADSHAKRHHGYKRKFHEKHHSHRGYRSNYLYDN
STMI:                    SSSSSSSSSSSSSSSSSSS                                
DO_DISOPRED3:            DDDDDDDDDDDD....D.....D...DDDDDDDDDDDDDDDDDDDDDDD.D
DO_IUPRED2A:             ..........................DDDDDD.DDD...............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                  ...DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                             .......DDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[RY]:                                       RhhgYkRkfhekhhshRgYR       
RICH_[H]:                                         HHgykrkfHekHHsH           
RICH_[K]:                                       KrhhgyKrKfheK               
RICH_[R]:                                        RhhgykRkfhekhhshRgyR       
RICH_[HK]:                                      KrHHgyKrKfHeKHHsH           
RICH_[HR]:                                       RHHgykRkfHekHHsHRgyR       
RICH_[HY]:                                        HHgYkrkfHekHHsHrgYrsnYlY  
RICH_[KY]:                                      KrhhgYKrKfheKhhshrgY        
RICH_fLPS_[HY]:                                akrHHgYkrkfHekHHsHrgYrsnYlY  
RICH_fLPS_[H]:                                 akrHHgykrkfHekHHsHrg         
RICH_fLPS_[Y]:                                       YkrkfhekhhshrgYrsnYlY  
RICH_MOBI_[H]:                                     HgykrkfHekHHsH           
RICH_MOBI_[Y]:                                       YkrkfhekhhshrgY        
RICH_MOBI_[HK]:                                    HgyKrKfHeKHH             
RICH_MOBI_[HY]:                                    HgYkrkfHekHHsHrgYrsnYlY  
RICH_fLPS_MOBI_[HY]:                               HgYkrkfHekHHsHrgYrsnYlY  
RICH_fLPS_MOBI_[H]:                                HgykrkfHekHHsHrgyrsn     
RICH_fLPS_MOBI_[Y]:                                 gYkrkfhekhhshrgYrsnYlY