P16860 ANFB_HUMAN

Gene name: NPPB
Protein name: Natriuretic peptides B

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- circulatory system process GO:0003013
- growth GO:0040007
- homeostatic process GO:0042592
- immune system process GO:0002376
- protein folding GO:0006457
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P07476 IVL 0.73958 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
2 O95813 CER1 0.67803 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell population proliferation GO:0008283
...
3 Q93086 P2RX5 0.67421 anatomical structure development GO:0048856
homeostatic process GO:0042592
response to stress GO:0006950
...
4 O60906 SMPD2 0.66348 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
5 P18074 ERCC2 0.63371 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biological process involved in symbiotic interaction GO:0044403
...
6 Q8IWF2 FOXRED2 0.63298 catabolic process GO:0009056
response to stress GO:0006950
7 P49454 CENPF 0.62822 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell cycle GO:0007049
...
8 Q9H410 DSN1 0.61901 cell cycle GO:0007049
cell division GO:0051301
chromosome organization GO:0051276
...
9 Q9UIG5 PSORS1C1 0.61894
10 Q02818 NUCB1 0.61866 cellular protein modification process GO:0006464
protein targeting GO:0006605
protein transport GO:0015031
...

                                           20                  40                  60                  80                 100
AA:                      MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRA
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSS                                                                          
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDD.......................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........DD..DDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:                                         DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:                                    DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................
RICH_[Q]:                                                           QeQrnhlQgklselQveQ                                       
RICH_[R]:                                                                                       RptgvwksRevategiRghR         
RICH_[EL]:                                                                LqgkLsELqvEqtsLEpLqE                               
RICH_[EQ]:                                                                 QgklsElQvEQtslEplQE                               
RICH_[LQ]:                                                         LQeQrnhLQgkLseLQveQ                                       
RICH_MOBI_[L]:                                                LetsgLqeqrnhLqgkLseL                                           
RICH_MOBI_[Q]:                                                      QeQrnhlQgklselQveQ                                       
RICH_MOBI_[EL]:                                                           LqgkLsELqvEqtsLEpLqE                               
RICH_MOBI_[EQ]:                                                            QgklsElQvEQtslEplQE                               
RICH_MOBI_[LQ]:                                               LetsgLQeQrnhLQgkLseLQveQ                                       

                                          120      
AA:                      PRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
STMI:                                                      
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ......DDDDDDDDD........DD.........
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....DDDDDD.....................DDD
RICH_[CG]:                       GsGCfGrkmdrissssGlGC