P18847 ATF3_HUMAN

Gene name: ATF3
Protein name: Cyclic AMP-dependent transcription factor ATF-3

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- carbohydrate metabolic process GO:0005975
- cell death GO:0008219
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8N3C0 ASCC3 0.66871 cell population proliferation GO:0008283
cellular nitrogen compound metabolic process GO:0034641
chromosome organization GO:0051276
...
2 Q92575 UBXN4 0.65846 catabolic process GO:0009056
response to stress GO:0006950
3 Q13402 MYO7A 0.65 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
4 Q9Y623 MYH4 0.63036
5 O43615 TIMM44 0.62009 protein targeting GO:0006605
protein transport GO:0015031
transmembrane transport GO:0055085
...
6 Q7L0Y3 TRMT10C 0.61653 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
7 O00230 CORT 0.60543 cell-cell signaling GO:0007267
signal transduction GO:0007165
8 Q8N6M0 OTUD6B 0.60188 biosynthetic process GO:0009058
cell population proliferation GO:0008283
cellular component assembly GO:0022607
...
9 P11055 MYH3 0.59983 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell differentiation GO:0030154
...
10 Q9NTN3 SLC35D1 0.58836 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSSALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAA
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............
DO_IUPRED2A:             DDDDDDDD...................................................................DDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ....................................................................................................
RICH_[AE]:                                                                                                ApEEdErkkrrrErnkiAA
RICH_[AR]:                                                                                                ApeedeRkkRRReRnkiAA
RICH_[E]:                                                                                               EvapEEdErkkrrrE      
RICH_[K]:                                                                                             KaevapeederKKrrrernK   
RICH_[R]:                                                                                                       RkkRRReRnkiaa
RICH_[S]:                         SaSevSaSaivpclSppgS                                                                        
RICH_[V]:                                                                                VtVsdrplgVsitkaeV                   
RICH_[EK]:                                                                                            KaEvapEEdErKKrrrErnK   
RICH_[ER]:                                                                                              EvapEEdERkkRRRER     
RICH_[KR]:                                                                                            KaevapeedeRKKRRReRnK   
RICH_fLPS_[R]:                                                                                                deRkkRRReR     

                                          120                 140                 160                 180                   
AA:                      AKCRNKKKEKTECLQKESEKLESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQS
STMI:                                                                                                     
DO_DISOPRED3:            ...DDDD.....................................................DDDD.DDDDDDDDDDDDDDDD
DO_IUPRED2A:             DD.......D...DDDD.....................................DDDDDD....DDDDDDDDD........
DO_SPOTD:                DDDD....................................................DDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDD....................................................DDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          .................................................................................
RICH_[AE]:               A                                                                                
RICH_[AR]:               A                                                                                
RICH_[R]:                akcR                                                                             
RICH_[IQ]:                                                                                     IQQIkegtlQ