O00230 CORT_HUMAN

Gene name: CORT
Protein name: Cortistatin [Cleaved into: Cortistatin-29; Cortistatin-17]

List of terms from Generic GO subset, which this protein is a part of:
- cell-cell signaling GO:0007267
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P57772 EEFSEC 0.8351 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
2 Q03113 GNA12 0.74657 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
3 Q8IZC7 ZNF101 0.68744 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
4 Q96DC7 TMCO6 0.68682 nucleocytoplasmic transport GO:0006913
protein transport GO:0015031
transport GO:0006810
5 O95972 BMP15 0.68613 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
6 O00168 FXYD1 0.67136 cellular protein modification process GO:0006464
circulatory system process GO:0003013
transmembrane transport GO:0055085
...
7 Q96JL9 ZNF333 0.66211 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
8 P41181 AQP2 0.65702 anatomical structure development GO:0048856
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
9 Q8NBP5 MFSD9 0.65123
10 Q13393 PLD1 0.65021 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular component assembly GO:0022607
...

                                           20                  40                  60                  80                 100
AA:                      MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQASAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKT
STMI:                    SSSSSSSSSSSSSSSSSS                                                                                  
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDD.................................DDDDDDDDDDDDDDDDDDDDDDDD..................
DO_IUPRED2A:             ....................DDDDDDDDDDDDDDDDDD............................DDDDDDDDDDDDDDDDDDDDD.............
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........
CONSENSUS:                                 DDDDDDDDDDDDDDDDDDDD....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............
CONSENSUS_MOBI:                            ..................................................................................
RICH_[AE]:                                                                          AsAgpligEEArEvArrqEgA                    
RICH_[AR]:                                                                                    ARevARRqegAppqqsAR             
RICH_[R]:                                                                                      RevaRRqegappqqsaR             
RICH_[ER]:                                                                                  EEaREvaRRqEgappqqsaR             

                                        
AA:                      FSSCK
STMI:                         
DO_DISOPRED3:            .....
DO_IUPRED2A:             .....
DO_SPOTD:                .DDDD
CONSENSUS:               .....
CONSENSUS_MOBI:          .....