P20292 AL5AP_HUMAN
Gene name: ALOX5AP
Protein name: Arachidonate 5-lipoxygenase-activating protein
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y223 | GNE | 0.70711 | |
| 2 | P51686 | CCR9 | 0.63981 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 cell differentiation GO:0030154 ... |
| 3 | Q9GZS1 | POLR1E | 0.6314 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 4 | Q92633 | LPAR1 | 0.58882 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 5 | Q14691 | GINS1 | 0.47952 | |
| 6 | O95497 | VNN1 | 0.42089 | |
| 7 | Q9UKF6 | CPSF3 | 0.40825 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 8 | Q12980 | NPRL3 | 0.40255 | anatomical structure development GO:0048856 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 9 | P20701 | ITGAL | 0.39808 | biological process involved in symbiotic interaction GO:0044403 cell adhesion GO:0007155 extracellular matrix organization GO:0030198 ... |
| 10 | O00161 | SNAP23 | 0.39211 | cell-cell signaling GO:0007267 cellular component assembly GO:0022607 immune system process GO:0002376 ... |
20 40 60 80 100 AA: MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVG STMI: MMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DD.................................................................................................. DO_IUPRED2A: ....................................D............................................................... DO_SPOTD: DDDDD............................................................................................... CONSENSUS: DD...... ...................... ... CONSENSUS_MOBI: ........ ...................... ...
120 140 160 AA: YLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP STMI: MM IIIIIIIIMMMMMMMMMMMMM DO_DISOPRED3: ............................................................. DO_IUPRED2A: ............................................................. DO_SPOTD: ............................................................. CONSENSUS: ..... ................................. CONSENSUS_MOBI: ..... .....................DDDDDDDDDDDD RICH_MOBI_[IL]: IsttIspLLLI RICH_fLPS_MOBI_[I]: IsttIsplllI