P22528 SPR1B_HUMAN

Gene name: SPRR1B
Protein name: Cornifin-B

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell death GO:0008219
- cell differentiation GO:0030154
- cellular protein modification process GO:0006464

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A0A1B0GTR4 SPRR5 0.85421
2 Q9UBC9 SPRR3 0.78724 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
3 P35321 SPRR1A 0.76409 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
4 Q9H0K1 SIK2 0.72838 cellular protein modification process GO:0006464
signal transduction GO:0007165
5 P35326 SPRR2A 0.72072 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
6 F8WCM5 INS-IGF2 0.7173
7 Q5W150 n/a 0.70966
8 P35325 SPRR2B 0.6999 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
9 P22532 SPRR2D 0.69965 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
10 Q9UKF5 ADAM29 0.68293 reproduction GO:0000003

                                           20                  40                  60                  80           
AA:                      MSSQQQKQPCTPPPQLQQQQVKQPCQPPPQEPCIPKTKEPCHPKVPEPCHPKVPEPCQPKVPEPCHPKVPEPCPSIVTPAPAQQKTKQK
STMI:                                                                                                             
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....DDD......DD.........................D...DDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......DD...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................
RICH_[PQ]:                  QQQkQPctPPPQlQQQQvkQPcQPPPQePciP                                                      
RICH_[P]:                        PctPPPqlqqqqvkqPcqPPPqePciP                       PkvPePchPkvPePcPsivtPaP        
RICH_[Q]:                   QQQkQpctpppQlQQQQvkQpcQpppQ                                                           
RICH_[CP]:                       PCtPPPqlqqqqvkqPCqPPPqePCiP                       PkvPePChPkvPePCPsivtPaP        
RICH_[CQ]:                    QkQpCtpppQlQQQQvkQpCQpppQepC                                                        
RICH_fLPS_[Q]:              QQQkQpctpppQlQQQQvkQpcQpppQ                                                           
RICH_MOBI_[PQ]:              QQkQPctPPPQlQQQQvkQPcQPPP                                                            
RICH_MOBI_[P]:                   PctPPPqlqqqqvkqPcqPPP                                                            
RICH_MOBI_[Q]:              QQQkQpctpppQlQQQQvkQpcQ                                                               
RICH_MOBI_[CP]:                  PCtPPPqlqqqqvkqPCqPPP                                                            
RICH_MOBI_[CQ]:               QkQpCtpppQlQQQQvkQpCQ                                                               
RICH_fLPS_MOBI_[Q]:         QQQkQpctpppQlQQQQvkQpcQ