Q5W150 YT011_HUMAN
Protein name: Putative uncharacterized protein MGC163334
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P0DN24 | C3orf86 | 0.90755 | |
| 2 | Q8WV24 | PHLDA1 | 0.8566 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell death GO:0008219 ... |
| 3 | Q9UKF5 | ADAM29 | 0.82101 | reproduction GO:0000003 |
| 4 | Q01826 | SATB1 | 0.81455 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 5 | Q9UBC9 | SPRR3 | 0.8085 | anatomical structure development GO:0048856 cell death GO:0008219 cell differentiation GO:0030154 ... |
| 6 | Q9H0K1 | SIK2 | 0.80734 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 7 | Q8N5C8 | TAB3 | 0.80093 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 8 | Q7Z739 | YTHDF3 | 0.79369 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
| 9 | E9PGG2 | ANHX | 0.79171 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 10 | Q13443 | ADAM9 | 0.78165 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MDCKSPKRANICPHLPGGGLFSTPPSQAAWRTLLTALCFPGPTCTGPMREGPRAVYNPPRAHRNSSDNCVMKHLLCAGDKNGTRRHALPSPLEGSFQPGR STMI: DO_DISOPRED3: DDDD................................................................................................ DO_IUPRED2A: .............DDDDDD..DDDDD......................DDDDDDDDDDDDDDD.................D.DDDDDDDDDDDDDDDDDD DO_SPOTD: DDDDDDDDDDDDDDDDD........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDD.........DDDD...............................DDDDDDDDDDDDDDD.................DDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ...............................................................................DDDDDDDDDDDDDDDDDDDDD RICH_[PQ]: QPgr RICH_[P]: PsPlegsfqPgr RICH_[Q]: Qpgr RICH_MOBI_[PQ]: QPgr RICH_MOBI_[P]: PsPlegsfqPgr RICH_MOBI_[Q]: Qpgr
120 AA: QIPPPQTPSTDPQTLPLSFRSLLRCHQLCAASLPPSLKLP STMI: DO_DISOPRED3: ......................................DD DO_IUPRED2A: DDDDDDDDDDDDDDD........................D DO_SPOTD: DDDDDDDDDDDDD....................DDDDDDD CONSENSUS: DDDDDDDDDDDDD.........................DD CONSENSUS_MOBI: DDDDDDDDDDDDDDD......................... RICH_[PQ]: QiPPPQtPstdPQ RICH_[P]: qiPPPqtPstdP RICH_[Q]: QipppQtpstdpQ RICH_MOBI_[PQ]: QiPPPQtPstdPQ RICH_MOBI_[P]: qiPPPqtPstdP RICH_MOBI_[Q]: QipppQtpstdpQ